SecReT6
Protein ID: 91212204
SecReT6 ID121
T6SS typei2
Gene symbol-
Locus tagUTI89_C3210
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3131040..3132416 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1R7K5
KEGG IDeci:UTI89_C3210
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 5.80E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|91212204|ref|YP_542190.1| hypothetical protein UTI89_C3210 [Escherichia coli UTI89]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLSLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
STIETTLQQCELWHMTKLDVLSGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3131040-3132416 Escherichia coli UTI89 chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACGTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGGCCAGACGTGGACTGGCGCCAAGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCTACCATAGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAGCTGGACGTATTGTCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCAGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAAGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA
 Primer design