SecReT6
Protein ID: 91783729
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2085
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2623466..2627563 [+]
Productmembrane protein, SciS/IcmF-like
NoteTssM
UniProt IDQ13YF6
KEGG IDbxe:Bxe_A2085
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.70E-99, Aligned region: 140..184
IcmF-related [PF06761], Evalue: 6.70E-99, Aligned region: 643..963
ImcF-related_N [PF14331], Evalue: 1.90E-93, Aligned region: 326..596
DUF1215 [PF06744], Evalue: 5.10E-33, Aligned region: 960..989
DUF1215 [PF06744], Evalue: 5.10E-33, Aligned region: 1071..1195
Protein Sequence: 1365 a.a.     [Download]
>gi|91783729|ref|YP_558935.1| membrane protein, SciS/IcmF-like [Burkholderia xenovorans LB400]
MSFTHSARDPFFAGKLKLSFLVSRQFLALVALLVVALVIWFVGPLVAFGGMKPLATVGMRVLVIALMLAG
VLLWLAGWSPSVFFVALLCLLIWQASPLLAFGREQPFMPASARVIAIALVLAIFVVYWAFRLWQKMRSDA
QFLKSLLEFGGRKEASPAAEQLANVQAIVSGALARLKAMRTGARGIGRLFQGKRYLYELPWYITLGSRGS
GKTTALLNAGLSFPVAAQMQRTIGALAGTESVDWWLTNDAVLIDTAGHYTRHGTSQRERLSSTLAAAAAK
SADKAKAASKNENASDKGKTAVAFSAQAGAAAGSSPGNPDAARLHEKTDADEWFGFLALLRKHRPRAPIN
GAILTLELATLTGLDENARMAEAAALRGRLAELRETLGIRFPVYLVITKMDRLSGFNEYFASLPAEGRAQ
SWGFTLPYGKETIAAQGVRTRCEEELGLLATRLADGVNTRLQDEFDSTRRRQLVALSEEFAALSQPLGEL
IERVFLDSRYDDTQLHATLRGVYFTSALQAGDTLVAERRTIAQRLAASFDRVAGARASRPGGNQSYFLHD
LLTRVVFAESQLVRPNLRWEFRFRLLRLIGHALAVLLFAWLAIGLRFSFGHNSDYLSLISRKTQALSAKV
AQLYKEPKAEAIPDTLTEARYLPAFPGLDLADPDSAYRFGLYTAPEIVTESSRTYDMLEDNLLLPQIVRR
VEDVIAQAVANRDSKAAYDALRVYLMLYDKARFNADDVKAWVLNDWANTDSAAAFGGRASMIGHVQQLFS
GSRVVQSPLIRNDSLVQQARSFLDGSNATERLYERARTAMQKEAPDEFTLIRAVGPQAGLVFTRASGAPL
SRGVPGLFTFDGYRQLFDKRLPEFVAAARDDDAWVMGRSYLGEAQKKTAEFVSAATGADDPLTDAIRRQY
LTEYARQWDAFLGDIRTVSGTSLQFNLQVLRSFAAPDSPLARLARAAVRETTLTQPATAADGSLLQKTTD
QLSQQADRTLGIRASEIVERELVDSHFAALREVVTGNADAQTAQAATAQAGKTGLDGVTNLLNDYYTSLT
VADNALANNSMPPASDTAAKLKMTANTMPPPFRAVLLALAGDGSREVNQGIGQLLSRQMQAVVGDTCRLT
IEGNYPFAADSRREVRIDDFTRVFAHGGIIDDFFTKTLATFVDTSAKPWRYRTLPGATEPVQGPDLEPFQ
HARAIREIFFADADQKQLSWKADIRVPELDPTISALMIDIDGQTLLYQHGPVTPFPVTWPGTRGGVRAEL
TAEPRIRPETSTLAADGPWALMRLVQKGQIVETTIPGRTRVAFDFDGRKAVLDIAAVGSVANPLTSDVLK
TFRCPSSMPTLTLTDSGPPPGLPQAAPPAAPDARD
 
Nucleotide Sequence: 4098 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2623466-2627563 Burkholderia xenovorans LB400 chromosome 1, complete sequence
GTGAGTTTTACACACTCAGCAAGGGATCCATTTTTTGCGGGCAAGCTCAAGTTGTCGTTTCTGGTATCGC
GCCAGTTCCTCGCACTCGTCGCGCTGCTCGTCGTCGCGCTGGTGATCTGGTTTGTCGGTCCCCTCGTGGC
GTTCGGCGGCATGAAGCCGCTCGCCACCGTCGGCATGCGCGTGCTGGTGATCGCGCTCATGCTGGCCGGC
GTGCTGCTATGGCTGGCCGGCTGGTCCCCCAGTGTGTTCTTCGTGGCGCTACTGTGTCTGCTGATCTGGC
AGGCCTCGCCGCTTCTCGCGTTCGGCCGTGAACAGCCGTTCATGCCCGCCTCGGCGCGCGTTATCGCGAT
TGCACTCGTACTGGCGATATTCGTCGTGTACTGGGCATTCCGGCTCTGGCAAAAAATGCGTAGCGACGCG
CAGTTCCTCAAGAGCCTGCTCGAATTCGGCGGCAGGAAAGAGGCCTCGCCCGCGGCGGAGCAACTGGCGA
ACGTGCAGGCGATCGTATCCGGCGCGCTGGCGCGCCTGAAGGCAATGCGCACCGGAGCGCGCGGAATCGG
GCGGCTGTTTCAGGGCAAACGCTACCTGTACGAACTGCCGTGGTACATCACGCTCGGTTCGCGGGGCTCC
GGCAAGACGACCGCCTTGCTCAATGCGGGATTGTCGTTTCCCGTCGCGGCGCAGATGCAGCGCACCATCG
GCGCGCTTGCCGGCACCGAGTCAGTCGACTGGTGGCTGACCAACGACGCAGTGCTGATCGATACCGCGGG
TCACTATACGCGGCACGGCACCTCGCAGCGTGAACGCCTGTCGTCGACGCTCGCTGCCGCGGCCGCAAAG
TCTGCTGACAAGGCGAAGGCTGCGTCGAAGAATGAAAACGCGAGCGACAAGGGCAAAACAGCCGTGGCGT
TCTCCGCGCAAGCCGGCGCGGCGGCAGGCTCCAGCCCGGGCAATCCGGATGCGGCCCGGTTGCACGAGAA
AACCGATGCGGACGAATGGTTCGGCTTTCTGGCGCTGCTGCGCAAGCACCGGCCGCGCGCGCCGATCAAC
GGCGCAATACTGACCCTGGAACTTGCCACGCTGACGGGGCTGGACGAGAACGCGCGCATGGCCGAAGCCG
CCGCGTTGCGCGGCCGTCTCGCGGAGCTGCGCGAAACGCTAGGCATCCGCTTTCCGGTTTATCTGGTCAT
CACCAAAATGGACCGGCTGAGCGGCTTCAATGAATACTTCGCTTCATTGCCGGCCGAGGGGCGTGCCCAG
TCCTGGGGCTTTACCCTGCCCTACGGCAAGGAAACCATTGCGGCCCAGGGCGTGCGCACTCGCTGCGAAG
AGGAACTCGGCCTATTGGCAACCCGTCTGGCCGACGGCGTCAACACGCGTTTGCAGGACGAATTCGATTC
GACCCGACGCCGGCAGCTTGTCGCGCTATCCGAAGAGTTTGCCGCGCTGTCGCAGCCGCTCGGCGAGTTG
ATCGAACGCGTGTTCCTCGACTCGCGTTACGACGACACGCAGCTTCACGCCACCCTGCGCGGCGTCTATT
TCACGAGCGCGCTTCAAGCCGGCGACACGCTGGTCGCCGAGCGGCGGACAATCGCACAGCGGCTGGCGGC
GTCGTTCGATCGGGTGGCGGGCGCGCGCGCGTCCAGACCGGGCGGCAATCAGAGCTACTTCCTGCACGAC
CTGCTCACCAGAGTGGTATTCGCCGAGTCGCAGCTCGTGCGGCCCAACCTGCGCTGGGAATTCCGTTTCC
GTCTGCTGCGGCTCATCGGCCATGCGCTCGCCGTGCTTCTGTTCGCGTGGCTCGCAATCGGGCTGCGGTT
CAGTTTCGGCCACAACAGCGACTATCTTTCGCTGATCAGCCGCAAGACCCAGGCGCTGAGCGCAAAGGTC
GCGCAACTGTACAAGGAGCCGAAAGCCGAAGCGATCCCCGATACGCTCACCGAGGCGCGCTACCTGCCGG
CCTTTCCGGGGCTCGACCTGGCGGACCCGGACAGCGCGTATCGTTTCGGCCTTTATACGGCACCTGAGAT
TGTCACCGAAAGCAGCCGCACTTACGACATGCTCGAAGACAATCTTCTGCTGCCGCAGATCGTGCGGCGT
GTCGAGGACGTCATCGCGCAGGCGGTGGCAAACAGGGATTCGAAGGCGGCCTACGACGCGCTGCGTGTCT
ACCTGATGCTGTACGACAAGGCCAGATTCAACGCCGACGACGTGAAAGCCTGGGTGCTCAACGACTGGGC
GAACACGGACAGCGCGGCGGCTTTCGGCGGCCGGGCCTCGATGATCGGGCACGTTCAGCAGCTCTTTTCA
GGCAGCCGCGTGGTTCAGTCACCGTTGATCCGCAACGATTCGCTGGTGCAGCAGGCACGTTCGTTCCTGG
ATGGCAGCAACGCCACCGAGCGTCTGTATGAACGCGCGAGGACGGCAATGCAAAAGGAAGCGCCCGACGA
ATTCACGCTGATCCGCGCGGTCGGACCGCAAGCCGGACTCGTCTTCACGCGGGCGAGCGGCGCGCCGCTG
TCGCGCGGCGTGCCGGGACTCTTCACCTTCGACGGATACCGCCAACTGTTCGACAAGCGCCTGCCCGAGT
TCGTCGCGGCCGCGCGCGACGACGACGCCTGGGTGATGGGCCGCTCCTATCTCGGCGAGGCTCAAAAAAA
AACGGCTGAATTCGTCAGCGCCGCGACCGGTGCCGACGACCCTTTGACCGACGCGATCCGCCGGCAATAC
CTGACGGAATACGCGCGACAGTGGGACGCGTTTCTGGGCGACATCCGCACGGTCAGCGGCACCAGTCTGC
AGTTCAACCTCCAGGTGCTGCGCAGTTTCGCGGCGCCGGATTCACCGCTGGCACGGCTCGCTCGCGCGGC
GGTGCGCGAGACCACGCTGACGCAACCCGCCACGGCGGCAGACGGCTCCCTCCTGCAGAAGACGACTGAC
CAACTCAGCCAGCAGGCGGACAGGACGCTCGGGATCCGGGCTTCGGAAATCGTCGAACGCGAGCTGGTGG
ATAGTCACTTCGCCGCGCTGCGCGAGGTGGTCACGGGCAACGCGGACGCCCAGACCGCCCAGGCTGCCAC
TGCGCAGGCCGGCAAGACCGGTCTGGACGGCGTGACGAATCTGCTGAACGACTACTATACGTCGCTGACG
GTTGCCGACAACGCGCTCGCCAACAACAGCATGCCGCCGGCGAGCGACACCGCGGCGAAGCTCAAGATGA
CCGCCAACACCATGCCGCCGCCGTTTCGCGCCGTGTTGCTGGCGCTCGCCGGCGACGGCTCGCGCGAGGT
GAATCAGGGCATCGGCCAATTGCTGTCGCGGCAGATGCAGGCGGTGGTCGGCGACACCTGCCGTCTCACG
ATCGAAGGCAACTATCCGTTCGCCGCCGACAGCAGGCGCGAGGTCCGTATCGACGACTTCACGCGCGTGT
TCGCGCATGGCGGCATCATCGACGACTTCTTCACGAAGACGCTCGCGACATTCGTGGATACCTCGGCGAA
ACCCTGGCGCTACAGGACGCTGCCCGGCGCCACCGAGCCTGTCCAGGGACCGGACCTCGAACCCTTCCAG
CACGCCAGGGCGATTCGCGAGATCTTCTTTGCCGATGCGGACCAGAAACAGTTGTCCTGGAAGGCCGATA
TCCGGGTTCCGGAGCTCGATCCGACCATCAGCGCCCTGATGATCGATATCGACGGCCAGACGCTGCTCTA
TCAGCATGGGCCGGTTACGCCGTTCCCGGTGACGTGGCCGGGCACACGCGGCGGGGTGCGCGCGGAGCTG
ACGGCCGAACCGCGCATCCGGCCGGAGACTTCGACGCTTGCGGCGGACGGTCCGTGGGCGCTGATGCGGC
TGGTTCAGAAAGGACAGATCGTCGAGACCACGATACCCGGCCGCACGCGGGTTGCATTCGACTTCGACGG
CCGCAAGGCCGTGCTCGATATCGCGGCGGTGGGCAGCGTCGCCAATCCGCTGACGAGCGATGTGCTGAAG
ACCTTCAGATGCCCGAGTTCGATGCCGACGCTCACCCTCACCGACAGCGGGCCGCCGCCGGGCCTGCCGC
AGGCGGCGCCACCCGCGGCCCCGGATGCGCGCGATTGA
 Primer design