SecReT6
Protein ID: 94309578
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0633
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]695874..699221 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ1LQQ7
KEGG IDrme:Rmet_0633
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.50E-69, Aligned region: 372..692
IcmF-related [PF06761], Evalue: 7.50E-69, Aligned region: 781..811
DUF1215 [PF06744], Evalue: 6.70E-34, Aligned region: 619..649
DUF1215 [PF06744], Evalue: 6.70E-34, Aligned region: 814..934
Protein Sequence: 1115 a.a.     [Download]
>gi|94309578|ref|YP_582788.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAYFHGTGSEPAWKQMELVALIGLAAVLLRGPIAAAWKTVASRSNERKRHQRDPAARVGKGAGSKINLAA
LQYANLKLALREHRCRRLPRLLVTGNDAAVSRLLPELEEAGWFDTCDALLLSSKTSNEGQPDTAWLKRLY
KLRRRRPVDAVIVVTDGAADLPMPRRGTHPYSIRLARIIEILRYAAPVYVVDVAGMDPTVSSDAPIIVCA
LPNQADASAIEEALLLLRNQLARRGLDQLTQEDRYPYQARLSQRFDTRSKALAKWTAGLIAGQIAVRGIA
FAPYPSGTSTKPEMPGSADLPHWRYLSEAARRQPGKRIGWHPMTVCVGFALVAVGLWFAGMLASGWFNSR
DVYAAQQAVTEIGSARNPATRLHALLALQQQIERYEYRTQQHAPLLTRFGLNRDADVLAALWQPYVKASR
ELLVTPVQQNLEATLVDLGQLQTTTLDDKTSQWALSGRDDLKAYLMLAYPERTEADFLAGRLPHDWSTEA
RITPGEKQALAERLFKFYAQHLKANPDWKIEPRPELVAGARQTLLAVIGARSAQETLYRGILNGAGNKYP
DLTLPSLTAGTDARGLLRSAAAVPGVFTRQAYEGYVADAIDAAATRRDVAADWVLTGSQVAAVTATKSAD
ELRAALTEQYFAEYAAHWQDFMNSLQWESAATLPAAIDQLKLLADARQSPAIALMKSLAYQGGAGVQKTS
LSDTLVNKAKDILGKKDDAPNSAKAAPAGPLDAAFGPVLRLAGQPGQAGQGGNNDLSLQRYLDRITALRL
RLQQVSIGADADDQARQMAQAMFQGKSSDLADTQAYAQLVAASLGAEWAGMGETLFVRPVAQATQAIVLP
AQASLNDVWQRFIMAEWNRIFAGRYPFANTTNDASLPELAQFLRPQGGTIQTFLATQLAGVLELQGDQWM
PAAGARGITFDPEFLKTINILQRIGAHMLVQGDPQYRFELKPIATPGLTDTKLTIDGQKLHYYNQRETWN
RMTWPASNLQDPGTLLQWQTEKAGTNKNYEYGGRFALLRMIGHGHIVPIDSATVQITWPAVPDTRGPLEE
STDAQSGKAPYEIRFLMRSEAGQGVLELLPLRGLKLPQRVFLVGKGGAAVDVPSPAARNAKRGGV
 
Nucleotide Sequence: 3348 bp     [Download]
>gi|94308945|ref|NC_007973.1|:695874-699221 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCGTATTTCCATGGCACTGGAAGCGAGCCAGCCTGGAAGCAAATGGAACTCGTGGCACTGATTGGCC
TGGCGGCAGTGTTACTGCGTGGCCCGATCGCCGCCGCCTGGAAAACTGTCGCGAGTCGCTCGAATGAACG
GAAGCGGCATCAGCGCGACCCGGCCGCGCGTGTCGGCAAGGGCGCTGGGTCGAAGATAAATCTCGCGGCA
TTGCAGTATGCGAACCTTAAGCTGGCGTTGCGGGAGCACCGCTGCCGCCGGCTACCGCGTCTGTTGGTGA
CGGGCAACGATGCCGCTGTTAGTCGGCTACTGCCGGAACTGGAGGAGGCGGGCTGGTTCGACACATGCGA
CGCGCTGCTGCTTTCGAGCAAGACCAGCAACGAGGGCCAGCCAGATACTGCCTGGCTTAAGCGACTCTAC
AAGCTACGCCGCCGCCGACCGGTGGACGCGGTGATTGTCGTCACCGATGGCGCGGCGGATCTCCCGATGC
CACGCCGTGGCACGCATCCTTACAGTATTCGCCTAGCACGGATCATCGAGATACTGCGCTATGCAGCGCC
GGTCTATGTGGTCGATGTGGCGGGAATGGATCCTACCGTCAGCAGCGACGCGCCGATTATCGTTTGTGCA
CTGCCGAATCAGGCAGATGCGTCTGCCATCGAAGAAGCGCTGCTATTGCTGCGCAACCAGCTGGCGCGGC
GCGGATTGGACCAGCTCACCCAGGAAGATCGTTATCCCTATCAGGCTCGACTGTCCCAGCGATTCGACAC
CCGTAGCAAGGCGCTGGCCAAATGGACTGCCGGTCTGATTGCTGGCCAAATTGCCGTCCGTGGCATCGCC
TTTGCCCCATACCCTTCGGGGACAAGCACTAAGCCCGAGATGCCAGGCAGTGCCGACCTGCCGCACTGGC
GCTACCTAAGTGAGGCGGCTCGCCGTCAGCCCGGCAAGCGAATCGGCTGGCACCCGATGACGGTGTGCGT
TGGATTCGCGCTGGTGGCAGTCGGCTTGTGGTTCGCAGGCATGCTGGCATCAGGCTGGTTCAACAGCCGG
GATGTTTATGCTGCGCAGCAAGCTGTCACGGAAATCGGTTCGGCACGGAACCCCGCCACCCGCCTGCATG
CACTGCTGGCCCTGCAGCAGCAGATCGAGCGCTACGAATACCGCACGCAGCAGCACGCGCCGCTGCTGAC
CCGCTTCGGCCTGAACCGCGACGCCGATGTGCTGGCCGCACTGTGGCAGCCCTACGTGAAGGCCAGCCGT
GAGCTGCTTGTCACGCCGGTGCAGCAGAATCTGGAGGCGACGCTGGTGGACCTCGGCCAGTTGCAGACTA
CGACGCTGGATGACAAGACCAGTCAGTGGGCGCTGAGCGGTCGCGATGACCTCAAAGCCTACCTGATGCT
GGCCTATCCGGAGCGCACCGAGGCCGATTTCCTTGCCGGGCGTCTCCCGCACGACTGGTCCACCGAAGCC
CGCATCACACCGGGAGAAAAACAGGCTCTGGCCGAGCGCCTGTTCAAGTTCTACGCGCAGCACCTGAAGG
CCAACCCGGACTGGAAGATCGAGCCGCGCCCCGAACTGGTGGCCGGTGCGCGACAGACGCTGCTGGCGGT
CATCGGCGCGCGCAGTGCCCAGGAGACGCTGTACCGGGGCATCCTGAATGGCGCCGGCAACAAGTATCCG
GACCTGACGCTGCCGTCGCTGACCGCTGGTACGGATGCGCGCGGCCTGCTGCGATCCGCCGCCGCTGTAC
CGGGTGTTTTTACGCGCCAGGCGTACGAAGGTTATGTGGCCGATGCGATTGACGCCGCCGCCACGCGTCG
CGATGTCGCCGCAGATTGGGTACTGACCGGCAGCCAGGTGGCTGCCGTCACGGCTACCAAATCCGCTGAC
GAACTGCGCGCGGCCCTGACCGAGCAGTACTTCGCCGAGTATGCCGCGCACTGGCAGGACTTCATGAACA
GCCTGCAGTGGGAGTCAGCGGCCACCTTGCCCGCCGCCATCGATCAACTCAAGCTACTGGCCGATGCGCG
CCAATCCCCGGCGATCGCGCTGATGAAGTCGCTTGCCTACCAGGGTGGTGCGGGTGTGCAGAAGACTTCC
CTGTCGGACACACTGGTGAACAAGGCCAAGGACATCCTCGGCAAGAAGGACGATGCGCCCAACAGCGCCA
AGGCGGCCCCGGCTGGCCCGCTGGACGCCGCGTTTGGCCCGGTACTGCGCCTGGCGGGACAGCCCGGTCA
AGCAGGGCAAGGCGGCAACAACGACCTGAGTCTGCAGCGGTATCTGGACCGGATCACGGCTTTGCGCCTG
CGCCTGCAACAGGTCAGTATCGGCGCCGACGCGGATGACCAGGCCCGCCAGATGGCGCAGGCGATGTTCC
AGGGCAAGAGTTCGGATCTGGCCGATACGCAGGCGTACGCGCAACTGGTAGCGGCGAGCCTCGGCGCGGA
ATGGGCGGGCATGGGCGAAACGCTGTTTGTGCGTCCGGTTGCGCAGGCGACGCAGGCCATCGTGCTGCCG
GCACAGGCCAGTCTGAACGACGTCTGGCAGCGGTTCATTATGGCGGAGTGGAATCGGATCTTCGCCGGGC
GTTATCCATTCGCCAACACGACCAACGACGCCTCGCTGCCAGAACTCGCGCAGTTCCTGCGTCCGCAGGG
CGGCACGATCCAGACGTTCCTGGCCACCCAGCTCGCGGGGGTGCTGGAGTTGCAAGGCGATCAATGGATG
CCTGCCGCTGGCGCGCGTGGCATCACGTTTGACCCGGAATTCCTCAAGACCATCAACATCCTGCAGCGCA
TCGGCGCCCACATGCTGGTTCAAGGGGACCCGCAGTACCGCTTCGAACTCAAGCCGATCGCGACGCCGGG
ACTCACCGATACGAAGCTCACCATCGACGGGCAGAAGCTGCACTACTACAACCAGCGTGAAACCTGGAAC
CGGATGACCTGGCCTGCGAGCAACCTCCAAGACCCGGGCACGCTTCTGCAATGGCAAACCGAGAAGGCAG
GCACCAACAAGAACTATGAATATGGCGGACGCTTTGCGCTGCTGCGCATGATCGGACACGGCCACATTGT
CCCGATCGATAGCGCCACGGTGCAGATCACGTGGCCTGCTGTGCCGGATACACGTGGCCCCTTGGAAGAA
TCCACCGACGCGCAGTCTGGCAAGGCGCCTTACGAGATTCGCTTCCTGATGCGTAGCGAGGCTGGCCAAG
GGGTATTGGAGTTGCTGCCCCTGAGGGGTCTCAAGCTGCCGCAGCGCGTGTTCCTGGTTGGCAAAGGCGG
CGCAGCAGTGGATGTGCCTTCGCCCGCAGCACGGAATGCTAAACGCGGAGGCGTGTGA
 Primer design