SecReT6
Effector Protein ID: 108762846
SecReT6 ID127
T6SS typeA1
Gene symbol-
Locus tagMXAN_4809
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6018067..6018558 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorMXAN_4809
DescriptionHcp protein
UniProt IDQ1D303
KEGG IDmxa:MXAN_4809
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.70E-31, Aligned region: 8..148
Protein Sequence: 163 a.a.     [Download]
>gi|108762846|ref|YP_632970.1| hypothetical protein MXAN_4809 [Myxococcus xanthus DK 1622]
MAESVHLYLKANGSDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGIEITKRIDKSS
PLLMKALCENQVIDATFKFFRPNPTGDGTTEQFYTVSIKKARINAIQQTVPNSFVPASTNLPPMETLQLV
FHTINWTITQGGVTHEDTWDTQR
-
Nucleotide Sequence: 492 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6018067-6018558 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGCTGAATCAGTACACCTGTACCTGAAGGCGAACGGCAGCGACATCAAGGGCGACAGCACGCAGACCA
GCCTGGGCCGCGCGGACTCCATCGAGTGCGTCGCGTACAGCCAGAAGGTCTTCACCGCTCGCGAGGCCGG
TTCGGGTCTGGCGACGGGCCGCCGCCAGTACGAGGGCATCGAAATCACCAAGCGCATCGACAAGTCGTCG
CCGCTGCTGATGAAGGCCCTCTGCGAGAACCAGGTCATCGACGCGACCTTCAAGTTCTTCCGTCCGAACC
CGACGGGCGACGGCACCACCGAGCAGTTCTACACGGTGTCCATCAAGAAGGCCCGCATCAACGCCATCCA
ACAGACGGTGCCGAACTCCTTCGTGCCGGCGAGCACCAACCTGCCCCCGATGGAGACCCTCCAGCTGGTG
TTCCACACCATCAACTGGACCATCACCCAGGGCGGCGTTACGCACGAGGACACCTGGGACACCCAGCGTT
GA
 Primer design

Reference
(1) Chang YW et al. (2014). Correlated cryogenic photoactivated localization microscopy and cryo-electron tomography. Nat Methods. 11(7):737-9. [PudMed:24813625] experimental
 
experimental experimental literature