SecReT6
Effector Protein ID: 113866681
SecReT6 ID143
T6SS typeA3
Gene symbolh16_A0654
Locus tagH16_A0654
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]696651..697136 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDQ0KDW9
KEGG IDreh:H16_A0654
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|113866681|ref|YP_725170.1| hemolysin-coregulated protein [Ralstonia eutropha H16]
MAQDIFLKINGIDGESQDSSHKNEVEVLAWDWSIEQQSTMHAGSGGGAGKATVSDLSFEHFIDRASPNLM
KYCLTGKHINEAVLVVRKAGGNPLEYLKLTMTDVIVTKVSPKGSVDDEVRMREKVALSFSRVKQEYVVQN
AQGGSGGAVTAGYDIKGNKEA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|113866031|ref|NC_008313.1|:696651-697136 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGCACAGGACATTTTCCTGAAGATCAATGGCATCGATGGCGAGTCGCAGGATTCGTCGCACAAGAACG
AAGTCGAAGTGCTGGCCTGGGACTGGAGCATCGAGCAGCAGTCCACCATGCACGCGGGCAGCGGCGGCGG
CGCCGGCAAGGCGACCGTGTCGGACCTGTCCTTCGAGCACTTCATCGACCGCGCCTCGCCCAACCTGATG
AAGTACTGCCTGACCGGCAAGCACATCAACGAGGCCGTGCTGGTGGTGCGCAAGGCCGGCGGCAATCCGC
TCGAATACCTGAAGCTCACCATGACCGACGTGATCGTCACCAAGGTGAGCCCCAAGGGCTCGGTGGATGA
CGAAGTGCGCATGCGCGAGAAGGTGGCGCTGTCGTTCTCCAGGGTGAAGCAGGAGTATGTGGTGCAGAAC
GCCCAGGGCGGCAGCGGTGGTGCTGTGACCGCGGGCTACGACATCAAGGGCAATAAGGAAGCCTGA
 Primer design