SecReT6
Effector Protein ID: 116053236
SecReT6 ID151
T6SS typeA4a
Gene symbol-
Locus tagPA14_67220
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]5999498..6001735 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDQ02ES7
KEGG IDpau:PA14_67220
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 2.10E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 2.10E-06, Aligned region: 293..332
PLDc_2 [PF13091], Evalue: 2.10E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 2.10E-06, Aligned region: 633..687
Protein Sequence: 745 a.a.     [Download]
>gi|116053236|ref|YP_793559.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAEIQRTLDSSE
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGNDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEAPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWGAHVGRLAETT
EKNFELWNQKMDDNWKAQVADEPFTSHLLRFWDVTTPYSQNLTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c6001735-5999498 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGTTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGGGTGCAGGCGCGGGTGCTGGTCTGGAGCAACCAGCTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCAGTG
GACAACGAGGTGCTGCGGCTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAACGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGAG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAAGTGCGCCTCGTCAACGGGCGGCTGCAAAGCCTGATCCAC
CTGTTGCGCGCCGATGGCAACGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGACCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCG
CAGGACGACGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGTGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGCACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCCGCCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCACCA
CCGTTGAAGGCACGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGACGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGGGCGCATGTTGGGAGGTTGGCCGAAACGACC
GAAAAAAACTTCGAATTGTGGAATCAGAAGATGGATGATAACTGGAAGGCCCAGGTGGCAGATGAGCCTT
TTACTTCGCACTTGCTGCGCTTCTGGGATGTCACTACACCCTATAGTCAAAATCTTACGGTGGACTGA
 Primer design