SecReT6
Effector Protein ID: 120553123
SecReT6 ID163
T6SS typeA1
Gene symbol-
Locus tagMaqu_0180
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]218118..218636 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDA1TX18
KEGG IDmaq:Maqu_0180
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-36, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|120553123|ref|YP_957474.1| hypothetical protein Maqu_0180 [Marinobacter aquaeolei VT8]
MPTPCYISIEGQTQGNITAGAFTSDSVGNIYVEGHEDEVLVQEFSHVVTVPTDPQSGQPSGQRVHKPFKF
TAALNKATPLMYNALASGEMLPKVELKWYRTSVEGKQEHFFSTILEDATIINIDCNMPHCQDPAKAEFTQ
LVEVSLAYRKVTWEHAVAGTSGADDWRSPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c218636-218118 Marinobacter aquaeolei VT8, complete genome
ATGCCAACTCCTTGTTATATCAGCATCGAAGGCCAAACCCAGGGTAACATCACCGCTGGCGCGTTCACTT
CCGATTCCGTAGGCAACATCTACGTTGAAGGTCACGAAGACGAAGTGCTGGTCCAGGAATTCAGCCACGT
TGTTACCGTTCCAACGGATCCCCAGTCCGGCCAGCCTTCCGGTCAGCGCGTTCACAAGCCGTTCAAGTTC
ACTGCGGCCCTGAACAAAGCCACTCCGCTGATGTACAACGCCCTGGCTTCCGGCGAAATGCTGCCGAAGG
TAGAGCTGAAGTGGTACCGCACTTCCGTAGAAGGCAAGCAAGAGCACTTCTTCTCCACCATCCTGGAAGA
TGCCACCATCATCAACATCGATTGCAACATGCCCCACTGCCAGGATCCGGCCAAGGCCGAGTTCACCCAA
CTGGTAGAAGTATCCCTGGCCTACCGTAAGGTTACCTGGGAGCACGCGGTTGCCGGTACTTCCGGTGCTG
ACGACTGGCGTTCTCCGGTCGAAGCCTGA
 Primer design