SecReT6
Effector Protein ID: 121597345
SecReT6 ID165
T6SS typeA1
Gene symbol-
Locus tagBMASAVP1_0611
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]621182..624205 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBMAA0737
Descriptiontype VI secretion system Vgr family protein
UniProt IDA1UW66
KEGG IDbmv:BMASAVP1_0611
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-67, Aligned region: 46..349
Phage_base_V [PF04717], Evalue: 3.00E-16, Aligned region: 396..489
Protein Sequence: 1007 a.a.     [Download]
>gi|121597345|ref|YP_990219.1| Rhs element Vgr protein [Burkholderia mallei SAVP1]
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKM
LSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIV
KRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQ
PGPADDLALRYLPATSLDAGIEADRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVS
SDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQA
HLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVT
RRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAG
QDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTA
LMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSV
GKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQL
GFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSAT
DVKLNGTNVKLNGSASLKFDGQLIQLG
-
Nucleotide Sequence: 3024 bp     [Download]
>gi|121596444|ref|NC_008784.1|:621182-624205 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGAACGCCGCGCCGTCCGCGAACGCGCGAC
GCTTCACGTTCGCGAGCGACGCGTACGACCCCGCGACATTCGACGTCGTCGACATCAACGGCCGCGACGC
GATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGCAGTTGCGGATCGACTTCGCGAAGATG
CTGAGCCGCGGGGCGACGCTCGCGATCCTGCCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCG
TGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTTCACCGTCTATCGCGCGACGCTCGTGCCGCG
CCTCTGGCGACTATCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTC
AAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGCGGCTACCGCA
AGCGCAGCTTCGTCTGCCAATACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAG
CCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGCGACCAGCCTCGACGCGGGCATCGAAGCGG
ACCGCGTGCAGGCGTTCACATGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGACTTCAACCA
CCGCAAGGCGGAGCTCTCGCTCGAAGTCCGCGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCG
AGCGACGAGCACTTCCACACGAAGGACGAAGGGCAGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCT
GCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCCGGCCGCTTCTTCGCGCTGTC
GGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGGCTCGCAGGCA
CACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGT
CGTCAGCGCGATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAG
GTGCGCTTTCCGTTCGCGCACACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGC
CCTACGCGGGCGACGACCGCGGCATGCACCTGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGA
CGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACG
CGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCG
CGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGC
GCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGA
ACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGA
CAGCGCATCGACACTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGG
CAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCG
TGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCAAGCTCGC
CGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGCGTGACCGGCGTCAGCACGGCG
CTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCG
ATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTC
GGCAAGGGCCGCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCG
CGGTGCCGGCCGACCCGACGACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGA
ATGCATGAAGGACATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAAC
ACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGCCCGCCGGCGCGCTCGCGGCGGTCGCGATCA
AGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTCGCGCTGAAGGTCGACAACCT
GCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCGCTTCCGACGCGCAGCTC
GGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAA
GATCGCGGCCGGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACC
GACGTCAAGCTGAACGGCACCAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGA
TCCAGCTCGGCTGA
 Primer design