SecReT6
Effector Protein ID: 123442905
SecReT6 ID171
T6SS typeA3
Gene symbol-
Locus tagYE2689
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2921360..2921845 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDA1JTM5
KEGG IDyen:YE2689
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|123442905|ref|YP_001006880.1| hypothetical protein YE2689 [Yersinia enterocolitica subsp. enterocolitica 8081]
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCFTHYTDKASPNLL
SYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANQQS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2921845-2921360 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGTCGCAAGATATGTTTATTAAAATTGATGGTATCGAAGGCGAATCTTTAGATGCTAACCACAAAAACG
AAATTCAGGTGCTGGCTTGGAAATGGGACGTTTCTCAGCACTCAAATATGCACAGTGGCTCAGGCGGCGG
TTCAGGTAAAGCAACTGTTTCTGACTTCTGTTTCACGCATTATACCGATAAAGCAAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCATATTAAGAATATCCAATTCGTTCTGCGTAAAGCAGGTGGCGATCCAC
TGGAATACCTGACTATTAAATTTACCGATGTAATCATCACTCGTGTTGATATGGCCGGTTCTCTTGAAGA
TGAAACTCGTCCACGTGAAGAGATTCGTTTCTCATTCACCAAGATGACTCAAGACTACGTTATGCAGAAT
GCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACCAGCAAAGCTAA
 Primer design