SecReT6
Effector Protein ID: 124385996
SecReT6 ID176
T6SS typeN/A
Gene symbol-
Locus tagBMA10229_A1818
StrainBurkholderia mallei NCTC 10229
Repliconchromosome I [GenBank: NC_008836] [Browse all T6SS(s) in this replicon]
Location [Strand]1859194..1859634 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDA2S776
KEGG IDbml:BMA10229_A1818
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0038, Aligned region: 45..116
Protein Sequence: 146 a.a.     [Download]
>gi|124385996|ref|YP_001027795.1| hypothetical protein BMA10229_A1818 [Burkholderia mallei NCTC 10229]
MPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|124383319|ref|NC_008836.1|:c1859634-1859194 Burkholderia mallei NCTC 10229 chromosome I, complete sequence
ATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTTCGGCAACGGCGCCTGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGAT
AACTTCTATGTCGTGGAGTAA
 Primer design