SecReT6
Effector Protein ID: 126448609
SecReT6 ID194
T6SS typeN/A
Gene symbol-
Locus tagBMA10247_2735
StrainBurkholderia mallei NCTC 10247
Repliconchromosome I [GenBank: NC_009080] [Browse all T6SS(s) in this replicon]
Location [Strand]2694865..2695305 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDA3MPS2
KEGG IDbmn:BMA10247_2735
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0038, Aligned region: 45..116
Protein Sequence: 146 a.a.     [Download]
>gi|126448609|ref|YP_001082258.1| hypothetical protein BMA10247_2735 [Burkholderia mallei NCTC 10247]
MPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|126447966|ref|NC_009080.1|:2694865-2695305 Burkholderia mallei NCTC 10247 chromosome I, complete sequence
ATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTTCGGCAACGGCGCCTGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGAT
AACTTCTATGTCGTGGAGTAA
 Primer design