SecReT6
Effector Protein ID: 126450729
SecReT6 ID194
T6SS typeN/A
Gene symbol-
Locus tagBMA10247_0659
StrainBurkholderia mallei NCTC 10247
Repliconchromosome I [GenBank: NC_009080] [Browse all T6SS(s) in this replicon]
Location [Strand]639532..642339 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDA3MIZ0
KEGG IDbmn:BMA10247_0659
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-46, Aligned region: 37..356
DUF2345 [PF10106], Evalue: 2.80E-44, Aligned region: 742..903
T6SS_Vgr [PF13296], Evalue: 5.20E-32, Aligned region: 579..687
Phage_base_V [PF04717], Evalue: 1.60E-18, Aligned region: 158..184
Phage_base_V [PF04717], Evalue: 1.60E-18, Aligned region: 423..520
Protein Sequence: 935 a.a.     [Download]
>gi|126450729|ref|YP_001080226.1| Rhs element Vgr protein [Burkholderia mallei NCTC 10247]
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLDAMLGQRVTIR
TALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTFVRQGVADVLGAVFAPYGAIA
RWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPED
ETSARMGGVPQRLSGTATEPDDVIVGIGQSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDV
GPEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVD
QIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGHGLQQTPRIGH
EVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHG
AGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRG
QGVELRSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRG
AQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQ
SLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQ
FPEKVCVECLKHAMQSGSALAGKAI
-
Nucleotide Sequence: 2808 bp     [Download]
>gi|126447966|ref|NC_009080.1|:639532-642339 Burkholderia mallei NCTC 10247 chromosome I, complete sequence
ATGAGCGTGATCACGCAATTCACGTCGCTTTTCAGCGCTGCCAATTGTCTCTATTGTCTCGACGGTCCGG
GCGAAATCGCGTCGCTGCAGATCGAGCGCTGGGTGGGGCGGGAGACGCTCTCCGAGAACTTCCAGTGGGA
TGTCTACGCGCTCGCGACCGATCCCGGCCTCGACCTCGACGCGATGCTCGGGCAGCGCGTGACGATCCGC
ACGGCGCTCGCGAACGGCACGAGCGCCGTGCGCAGCGGGCTCGTGGCGCAGGCCGAGTGCATCGGCTACG
ACGCCGGCCTCGCGCGCTACTGCCTGCAGCTCGTGCCGTGGCTCGCCGCGCTCGCGCACGGCCGCGACGA
GCGCACGTTCGTGCGGCAGGGCGTCGCCGACGTGCTCGGCGCGGTGTTCGCGCCGTACGGCGCGATCGCC
CGCTGGCGCTTCACCGCGGACGCGAACCAGCGCATCGCGGAACTCGGCGCGCGCGACTACCGCGTGCAGT
ACCGCACCCACACGCATTTCGATTTCGTCCGGCACGTGCTTGCCGAAGCGGGTCTCGGCTTTTGCTTCGT
CGAGGAGGCGGACGCGCCCGCGGGCCACACGATGCTGATCTTCGACGACAGCACGCAGTTGCCCGAGGAC
GAGACTTCCGCGCGCATGGGCGGCGTGCCGCAGCGGCTGAGCGGCACGGCGACCGAGCCGGACGACGTGA
TCGTCGGCATCGGGCAGTCGCTGTCGCTGACCGCGGATCGCGTCACGCTGATCAGCAGCGACTACCGCGG
CAACCAGTCGACGAGCGCGACGGCGAGCCTCGGCAATCCGGCCGGATCGCGCGAGCTGTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCCTGCGCGAGGCCGACGCCGCCGCGCGGCGGCACGCGGACGCGATCGTCT
CGGCGGCGCGCTTCTGGACAGGCTACGGCACGTTGCGCACCGCGCGCGCTGGCCGCGCGCTGCGCATCGC
GGGCGCGACGTGGCGCATGTCGCGCGGCGGCGCGCCGGCGCCCGATGCGTTCGTGTTGACGCGCGTCGAT
CAGATCGGCATCAACAATTTGCCCGCGACGGTGATGGAGCGCGTCGAGCGCAGCCTCGGCCCGCTGCCGC
CCGCGAATCTCGACGCGCGCGTGCTCGCGCAGGCGAAGGCGGGCGGCTATGCGAACCGGTTCGACGCCGC
GCCGCGCGACCAGGCATGGCGCCCGACGCTGGAGGACGGCACCGGCCAGCGACTGAACCCGGTGCCGACG
GCGCTCGGCGCGCAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGACGCGGCCGGGCTCGACGGGCCCGG
TGCATACCGACGCGCAGGGCCGGTTGCGGCTGCGCTATCACTGGCAGGCGGACGGCGACGCGGGCACCTA
TCCGACGCGCGCGATGCAGCGGCTCGCGAGCGAGGGGCACGGGCTGCAGCAGACGCCGCGGATCGGCCAC
GAGGTGCTCGTGCAGTTCGTCAACGGCCTCGTGCACCGGCCGATCGTGCTCGGCGGGCTGTTCAACGGCC
GCGGCGAGGGCGGCGAAGCGCCGACGCCCGGCGGCGAAGCGGGGCAGCCGCTCGACGAATCGGTCTACGC
ACAGGCGAGCGACCACGCGGCGAGCGCGCAAGGCAATCTTGCGGGCGGCCATAGCCCCGCGTGGCACGGC
GCGGGCGGCGGCGCGAAGCGCCACGATCACGCGGGCGCGCTGTCCGGCTTCAAGAGCCAGGAGTTCGACG
GCCAGGGCTACAACCAGCTCGTCGCGGACGATACCGATCGCATGGGCCGCATGCAGATGGCGACGACGCA
CGCGGCGACCCAGCTCAATATCGGCCATTTGCGGCATCAGGCCGACAACTATCTCGGCAGCTTCCGCGGG
CAAGGCGTCGAGCTGCGCTCGGACGCGTACGGCGCGCTGCGCGGCGCGCGCGGCGTGCTGATCTCCAGCT
ATGCGCCGACGGGGCCGTCGCAGCCGGCGGGCGATGCGTCGGCGCTGCAGTCGCTGCTCGCGCAACAGGC
GGCGCTCGCGAAGCTTCTCGACAAATCGGCGGACACGCACAAGACCTTGCCGTTCGCCGCGCAGCGTGGC
GCGCAGCGGGCCGGACAGTCGTCGATGAACGGCGACGCCGCGCCGCTCGACGCGCTCGGGAAGAGTTTCG
CGACGACGGTCGGCGCCGACGGCTACGCGCAGGCGTCGGCCGACGCATCGCGCCGCGCGACGGGCAATGC
GCTGCCGCATACCGGCGACGCGGTGCTCGGCGTCGAGGCGAAGGGCGGCCAGGGGCTGCTGGCCGGCCAG
TCGCTGCAATGGGCGGCGGGCGAGACGCTGACCATCGGCAGCGGCAACGACACCAACCTCGCGGTCAACC
GGACGTTGCGCGTGCACAGCGGGCAGGGCATCGGCTGGCTTGCCGGCGCGAACGGCGCGAACGGCGCGCA
GGGCGTCGGCATGAGCGTGATCGCCGGCAAGGACGATCTGGCGCTGCAGGCGCAGCACGACCTGATGGCG
CTGCGCGCGCGCGACGATCTGAGGGTCGCGTCGATCGGCGCGGACGTCGAGATCGCGGCGAAGCAGACCG
TGCGGCTCGCGGTCAGCGGCGGCGCGCATCTGACGATCGAAGGCGGCAACGTCACGTTCGGCTGCCCGGG
CTCGCTCGTCGTTCATGCGGCCCAGCATACGTTCGTCGGGCCGGATCAACTGGCTCCCGCGCTGCCGCAG
TTTCCCGAGAAGGTGTGCGTCGAATGCCTGAAGCACGCGATGCAATCGGGCAGCGCACTGGCCGGCAAGG
CGATCTGA
 Primer design