SecReT6
Effector Protein ID: 126641342
SecReT6 ID195
T6SS typeA4b
Gene symbol-
Locus tagA1S_1296
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1521756..1522259 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDA3M480
KEGG IDacb:A1S_1296
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|126641342|ref|YP_001084326.1| hypothetical protein A1S_1296 [Acinetobacter baumannii ATCC 17978]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1521756-1522259 Acinetobacter baumannii ATCC 17978, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTAAAAGACTTAGATGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGTGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA
 Primer design

Reference
(1) Weber BS et al. (2013). Genomic and Functional Analysis of the Type VI Secretion System in Acinetobacter. PLoS One. 8(1):e55142. [PudMed:23365692] experimental
 
experimental experimental literature