SecReT6
Effector Protein ID: 152984462
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3979
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]4123474..4123950 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDA6V8E8
KEGG IDpap:PSPA7_3979
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|152984462|ref|YP_001349333.1| hypothetical protein PSPA7_3979 [Pseudomonas aeruginosa PA7]
MSYDYEKTSLTLYRAIFKANYEGDVGRYLRPDKELAEAAEVAPLLHPTFDSPSTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4123474-4123950 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTCCTACGACTACGAGAAGACCAGCCTCACCCTCTACCGGGCGATATTCAAGGCCAACTACGAGGGCG
ACGTCGGTCGCTACCTGCGCCCCGACAAGGAACTCGCCGAGGCCGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAGCACCCCCGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATCCCCGACGGCACCGACATCCCGCCGGACCTGAAGGTGAAGCAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAGCTG
GACAACTTCGTGCGCAACGCCATCCGTCGCCAATGGGAAAAAGCCCGCGGGCTCTAG
 Primer design