SecReT6
Effector Protein ID: 152985313
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3959
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]4099703..4103662 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2684
DescriptionTse5
UniProt IDA6V8C8
KEGG IDpap:PSPA7_3959
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 112..118
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 198..222
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 275..309
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 322..340
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 371..398
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 383..416
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 428..463
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 448..485
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 474..499
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 491..527
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 512..548
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 533..570
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 576..611
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 617..653
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 638..669
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 687..711
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 705..743
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 797..807
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 801..834
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 823..856
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 844..872
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 929..962
RHS_repeat [PF05593], Evalue: 2.10E-58, Aligned region: 950..983
RHS [PF03527], Evalue: 1.10E-14, Aligned region: 499..522
RHS [PF03527], Evalue: 1.10E-14, Aligned region: 594..611
RHS [PF03527], Evalue: 1.10E-14, Aligned region: 1068..1106
Protein Sequence: 1319 a.a.     [Download]
>gi|152985313|ref|YP_001349313.1| hypothetical protein PSPA7_3959 [Pseudomonas aeruginosa PA7]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGCKLLPEEVDFALAAPD
TFTFARGYLSSNPRVGRLGQGWWLPGESMHLELGDEACVLVDAQGRRIAFPALAPGAQFYSGSEELWLRR
GGSNREDGEVEAWRGRWAAVPAELRAQEASVLVLSGHSYLHFLRHPDGIWRLQASFGRAGYRTEYRWSGR
GLLTGVRDSAGRSYALVYQQACAPSEGDDGLRLFGVILASHDGPAPDHIDPQDPGLDWLVRYQFNDSGDL
IAVRDRLGQVVRVFAWHAHMLVAHGEPGGLEVRYEWDVHAPHGRVLKQIEAGGLTRSFRYLRDATEVSDS
LGRVERYEFAGEGGQRRWTALVRADGSRTEFDYDLFGRLVALRDPLGRETRRRRDGQGRTLEEETPGKAR
YRKTLDEETGLLVELEDAMQRRWRFERDERGNPVTVHGPAGSTRYRYEDARLPDRPTRIVDPRGGERRLE
WNRLGLLAALTDCSGQTWRYEYDSEGRLTCETDPLGQVTRRRYDPLGQLIGLALADGSALGYAYDALGRQ
TRISDAEGRATLFSWGHGDLLALVSDASGRELSYQHDEAGRLLTLTNENGAQAHFRYDPLDRLVEETGFD
GRRQRYRYNAADELVAREDADGRETAYAYDRDGRLASVRIPASDAAPALVERYRWLADGRLASAVGPDCE
VRYEYDEVGNLRLESQLHADGWVYSVEHSHDELGMRQTSRYGDAPPVTWLTYGAGHLHGALVGAIELAFE
RDALQREVRRDARHGGKSDALFVQERRYGALGRLQESRLRLAGGADWQRGYRYDGLGQLVGIDDNQQPAV
RYEYDLAGRLLGSRRAGLPDRRYHYDAAGNRLDDEVANRREAGRQAFEHNELYRSGFTRSASGESETGEA
PQRWLGNRVQRIAGNRYHFDAQGNLVERVGADGERLRLAYDGAQRLVRLTREAADGTRVEARYRYDALSR
RIAKSVLRDGVEQQVRFGWDGDRQCAEAFERQLRTTVHEPGGFVPLLRLEQAREPDTPELLELRRTFAAE
GQPLPAQCVPELGEARFAFFHTDHLGTPLQLSDERGQLRWQGVAHDWRAVEPDREPGAQPIRFQGQYHDE
ESGLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYTYALNAPSVAYDPTGLIIPLVVIGAFAARAAIGAAL
GAGIELGMQTGKQVLGQMKDNWDNDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSARAI
RTLSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3960 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c4103662-4099703 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAGCGGGCTACCCGTTTCCCATGTCGGTGAAAAAGTCTCGGGAGGCGTGATCTCCACCGGCTCTCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCGGCCTGCGTGCCGCTGGTGGGCAA
ACCGGTCAACCCGATGCTCGGGTGCAAGTTGTTGCCGGAGGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGCGGCTACCTGTCGAGCAATCCGCGGGTCGGGCGGCTCGGCCAGGGCTGGTGGC
TGCCGGGCGAAAGCATGCATCTGGAACTGGGTGACGAGGCTTGCGTGCTGGTCGATGCCCAGGGGCGGCG
GATCGCTTTTCCCGCCCTGGCGCCGGGCGCGCAGTTCTATTCCGGCAGCGAGGAGCTCTGGCTGCGCCGC
GGCGGCTCGAACCGCGAGGACGGCGAGGTGGAGGCCTGGCGCGGACGCTGGGCGGCGGTGCCGGCCGAAC
TCCGGGCGCAGGAAGCCTCGGTGCTGGTGCTCTCGGGCCACAGCTACCTGCACTTCCTTCGCCATCCCGA
CGGTATCTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGTACCGAGTACCGCTGGAGCGGACGC
GGTCTGCTCACCGGCGTGCGCGACAGCGCCGGACGCAGCTATGCGCTGGTCTACCAGCAGGCCTGCGCGC
CGAGCGAGGGCGACGACGGCCTGCGCCTGTTCGGCGTGATCCTGGCCAGCCACGACGGCCCGGCGCCGGA
CCATATCGACCCGCAGGATCCCGGGCTCGACTGGCTGGTGCGCTACCAGTTCAACGACAGCGGCGACCTG
ATCGCCGTGCGCGATCGCCTTGGCCAGGTGGTGCGGGTGTTCGCCTGGCACGCGCACATGCTGGTCGCCC
ATGGTGAGCCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCCCCGCACGGGCGGGTGCTGAA
ACAGATCGAGGCGGGCGGCCTGACCCGCAGCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGC
CTCGGCCGCGTCGAACGCTACGAGTTCGCCGGCGAAGGCGGGCAGCGGCGCTGGACGGCGCTGGTCAGGG
CTGACGGCAGCCGCACCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCCTGCGCGACCCGCTGGG
CCGGGAGACCCGGCGCCGGCGCGATGGCCAGGGGCGGACGTTGGAAGAGGAGACGCCGGGCAAGGCGCGT
TACCGCAAGACGCTCGACGAGGAGACCGGGCTGCTGGTCGAACTGGAGGACGCGATGCAGCGCCGCTGGC
GCTTCGAGCGCGACGAGCGGGGCAACCCGGTCACCGTGCACGGCCCGGCCGGCAGCACCCGCTATCGCTA
CGAGGACGCGCGCCTGCCCGACCGGCCGACGCGGATCGTCGATCCGCGTGGCGGTGAACGACGCCTGGAG
TGGAACCGGCTCGGCCTGCTGGCGGCGCTGACCGACTGTTCCGGCCAGACCTGGCGCTACGAATACGACA
GTGAAGGACGCCTGACCTGCGAGACCGATCCGCTGGGCCAGGTCACCCGGCGCCGCTACGATCCGCTGGG
CCAGTTGATCGGCCTGGCCCTGGCCGATGGCAGCGCCCTCGGCTACGCCTACGACGCTCTCGGAAGGCAG
ACCCGGATCAGCGATGCCGAGGGCCGGGCCACGCTGTTTTCCTGGGGGCATGGCGATCTGCTGGCGCTGG
TCTCCGATGCCAGCGGTCGCGAGTTGTCCTACCAGCACGACGAGGCTGGCAGGCTGCTCACCCTGACCAA
CGAGAACGGCGCCCAGGCGCATTTCCGCTACGACCCGCTCGACCGCCTGGTCGAGGAGACCGGCTTCGAC
GGGCGTCGCCAGCGCTACCGCTACAATGCCGCCGACGAGCTGGTTGCCCGCGAGGACGCCGACGGTCGGG
AGACCGCCTATGCCTACGACCGCGACGGTCGCCTGGCGAGCGTCCGGATCCCGGCCAGCGATGCTGCGCC
GGCGCTGGTCGAACGTTACCGCTGGCTGGCCGACGGCCGCCTGGCCAGTGCCGTCGGGCCGGATTGCGAA
GTCCGCTACGAGTACGACGAGGTGGGCAACCTGCGCCTGGAAAGCCAGCTACATGCCGATGGCTGGGTCT
ACAGCGTCGAGCACAGCCACGACGAGCTGGGCATGCGTCAGACCAGCCGCTACGGCGACGCGCCGCCGGT
GACCTGGCTGACCTACGGCGCCGGTCACCTGCACGGCGCGCTGGTCGGCGCCATCGAGCTGGCCTTCGAG
CGTGACGCCCTGCAGCGCGAGGTGCGTCGCGACGCGCGCCATGGTGGGAAGAGCGATGCGCTGTTCGTCC
AGGAGCGCCGCTACGGTGCGCTGGGGCGCCTGCAGGAGAGTCGCCTGCGCCTGGCCGGGGGCGCCGATTG
GCAACGTGGCTATCGCTACGACGGACTCGGGCAACTGGTGGGCATCGACGACAACCAGCAGCCGGCCGTG
CGCTACGAATACGACCTTGCCGGCCGCCTGCTCGGCAGCCGGCGAGCCGGCCTGCCGGACCGCCGCTACC
ACTACGACGCCGCCGGCAACCGCCTGGACGACGAGGTGGCGAACCGGCGCGAAGCGGGTCGCCAGGCCTT
CGAGCACAACGAACTGTACCGTTCCGGGTTCACTCGCTCCGCAAGCGGCGAGAGCGAGACCGGCGAGGCC
CCGCAGCGCTGGCTCGGCAACCGGGTGCAGCGGATCGCCGGCAATCGCTACCACTTCGATGCCCAGGGCA
ACCTGGTGGAGCGCGTCGGTGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGT
CCGGCTGACGCGCGAGGCTGCCGACGGCACGCGGGTGGAGGCGCGCTATCGCTACGACGCACTGTCGCGG
CGGATCGCCAAGAGCGTGCTGCGCGACGGCGTCGAGCAACAGGTGCGTTTCGGCTGGGACGGCGACCGCC
AGTGCGCCGAGGCCTTCGAGCGGCAGCTGCGCACGACGGTTCACGAACCGGGCGGTTTCGTCCCGCTGCT
GCGCCTGGAGCAGGCCCGCGAACCCGATACCCCGGAACTGCTCGAGCTGCGCCGGACGTTCGCTGCCGAA
GGCCAGCCGCTGCCGGCGCAATGCGTGCCGGAACTGGGCGAGGCGCGGTTCGCATTCTTCCATACCGATC
ATCTCGGGACCCCCCTGCAACTCAGCGACGAACGCGGGCAACTGCGCTGGCAGGGCGTCGCGCACGACTG
GCGGGCGGTCGAGCCGGACCGCGAGCCCGGCGCGCAGCCGATCCGCTTCCAGGGCCAGTACCACGACGAG
GAAAGCGGCCTCTACTACAACCGCTATCGCTATTACCTGCCCGAGGCCGGCCGCTACGCCAGCCAGGATC
CGCTCGGCCTGGGCGGCGGGCCCAATCCCTATACCTATGCGCTGAACGCGCCGTCGGTGGCCTACGACCC
CACCGGCCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCGCGGGCCGCGATCGGCGCGGCGCTG
GGCGCCGGTATCGAGCTGGGCATGCAGACCGGCAAGCAAGTGCTGGGACAGATGAAGGACAACTGGGACA
ACGATCGCGATCTCACCGACATCAAGTGGAAGTGCATCGACATCAACTGGAAGCATGTCGGCGCCTCGGC
GGCGATCGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACGGTGGTCCAGTCGGCGAGGGCGATC
AGGACCCTCTCGGGGCAGGCGGCGAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCGC
ATGCCGATACCATCAAGAAGGCGGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAGTG
CCCGCTGAAGGACGAAGAAGAGGAGTGCCCACCGCAATGA
 Primer design