SecReT6
Effector Protein ID: 152985781
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_1642
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]1679339..1680565 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDA6V1U1
KEGG IDpap:PSPA7_1642
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|152985781|ref|YP_001347026.1| hypothetical protein PSPA7_1642 [Pseudomonas aeruginosa PA7]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTLQRYQARNALLRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPTDLPSIALGDQFKLLNKDPATVTKYSNPLRDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSLKGANTSIGLGQ
VVVSTAIKYELFTDLLAQPVRRGLSRKAIATLLASDEFNIFATARYIRYVANLAAQQDLRRLPKTRSAFP
TIDLRAYAGNPRNWPRDNIRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPAMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c1680565-1679339 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCACTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCCTGCAGCGCTACCAGGCACGCAATGCCTTGCTCCGCAGCCTGATCAACA
ATCCCCTGGGTACCCAGACCGACAACTGGATCTACTTCCCCACCATCACCTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCCGGCCGCCTGGGCTTCGCCGCGGCCGGCGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATCGCCCTCGGCG
ACCAGTTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCCGCGACCTGGG
CGCCTACCTGAGCCAGCTGTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCCGCCGCGC
GCAAGTACGACCTGACACCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAACGCGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCGGTCAGCCTCAAGGGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGCCCAGCCGGTGCGCCGCGGCC
TGTCGCGCAAGGCGATCGCCACCCTGCTGGCTTCCGACGAGTTCAACATCTTCGCCACCGCCCGCTACAT
CCGCTACGTCGCCAACCTGGCGGCGCAGCAGGACCTGCGCAGGCTGCCAAAGACCCGGAGCGCGTTTCCC
ACCATCGATCTGCGCGCCTACGCCGGCAATCCGCGCAACTGGCCACGGGACAATATCCGCGCGCTGGCCT
CGGAATACACTTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCCGCAATGAGGTTCCCATGA
 Primer design