SecReT6
Effector Protein ID: 152985902
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_0157
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]173030..173518 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDA6UXL8
KEGG IDpap:PSPA7_0157
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|152985902|ref|YP_001345553.1| hypothetical protein PSPA7_0157 [Pseudomonas aeruginosa PA7]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPIKYGWNIRQNVQA
-
Nucleotide Sequence: 489 bp     [Download]
>gi|152983466|ref|NC_009656.1|:173030-173518 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGG
AAATCGACGTGCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGG
CGCCGGCAAGGTCAACGTGCAGGACCTGTCGTTCACCAAGTATATCGACAAGTCCACGCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGCGG
CGAAGACCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAG
GCCGATGGCGCGAAGGACGGCGGTCCGATCAAGTACGGCTGGAACATTCGCCAGAACGTACAGGCCTGA
 Primer design