SecReT6
Effector Protein ID: 152985978
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3960
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]4103712..4105781 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDA6V8C9
KEGG IDpap:PSPA7_3960
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-84, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 6.70E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 511..527
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 554..575
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 3.40E-08, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 0.00068, Aligned region: 650..683
Protein Sequence: 689 a.a.     [Download]
>gi|152985978|ref|YP_001349314.1| hypothetical protein PSPA7_3960 [Pseudomonas aeruginosa PA7]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFNHELELVSSNHALPLDALLGKPMSLALELPGGIR
RHFHGIVARCSQGAGSGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALTRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHQSPVGYASVPYYPPTLGHRER
DHFFDWHVAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQHERVRLRGCARGIGSGHLFHLSNYPRLDQNREYLVVAAEYRVVQELLETGNGGAGAQFESELDCI
DAAQPFRPLPLTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAEKNQDIEVENDETHWVGHDRSKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVKIGMNKSETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKIGLDGRSIVLGSQRIELTADREILLRCGQSTIRITPAEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c4105781-4103712 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCTGTTCTCCCAACATACCCGCCTGGTCCACGTGGATTCCCCTTTGGGCCCCGAGGTCCTGCAACTGC
AACGGCTGGAAGGCCGCGAAGAGTTGGGCAGGCTGTTCAACCACGAGCTCGAGCTGGTTTCGAGCAATCA
CGCCCTGCCCCTGGACGCCCTGCTGGGCAAGCCGATGAGCCTGGCACTGGAATTGCCCGGCGGCATCCGG
CGGCATTTCCACGGCATCGTCGCGCGCTGCAGCCAGGGTGCCGGCAGCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTCACGCGCACCTCCGACTGTCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGATCTCGGCTTCTCCGACTTCGAGGATGCCCTGACACGCCCC
TACCGCGAGTGGGAGTACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAGGGCATCTACTACTGGTTCCGCCACGAGAAGAAGCGCCACATCCTGGTCCTCTCCGACGCCTACGG
TGCGCACCAGAGCCCGGTCGGCTACGCCAGCGTGCCTTACTACCCGCCGACCCTCGGCCACCGCGAGCGC
GACCATTTCTTCGACTGGCACGTGGCGCGCGAGGTCCAGCCCGGTTCGCTGAGCCTCAACGACTACGATT
TCCAGCGTCCCGGCACCCGCCTGGAGGTGCGCTCCAACGTGGGGCGCGCCCATGCGGCGGCGGACTACCC
GCTGTACGACTACCCCGGGGAATACGTGCAGAGCCAGGATGGCGAACACTACGCGCGGACCCGCATCGAA
GCGATCCAGACCCAGCACGAGCGGGTACGCCTGCGCGGTTGCGCCAGGGGCATCGGCTCCGGGCACCTGT
TCCACCTGAGCAACTATCCGCGGCTCGACCAGAACCGCGAGTACCTGGTGGTGGCGGCGGAATACCGGGT
GGTCCAGGAGCTTCTCGAGACCGGCAATGGCGGCGCCGGAGCGCAGTTCGAGAGCGAACTGGACTGCATC
GATGCCGCCCAGCCGTTCCGGCCGTTGCCGCTGACGCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGACCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATGCGCGTATCCCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAGGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACAGTGCCTTACGAACTGCCGGCGAACGC
CACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGCTGTACATCCACGCGGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGTCACGACCGCAGCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACGGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTGGAC
CGCAACGAAACGGTGAAGATCGGCATGAACAAGAGCGAGACCATCCTCATGGCCTCGCTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGCCTCGGCTACAGCCTCAATGTCGGCATGATGATGAACACGGTGGT
CGGGTTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCCTGTCGGTGGGCGACAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGACGGGTCGAAGATCGGCCTGGACGGCAGGAGCATCGTCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCCTGCGCTGCGGGCAGAGCACCATCCGCATCACCCCGGCGGA
GATCGAGATCCTCTCGCCGAACGTCGATATCAACTGTTGA
 Primer design