SecReT6
Effector Protein ID: 152987248
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3448
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3574266..3574736 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDA6V6X3
KEGG IDpap:PSPA7_3448
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0001, Aligned region: 29..99
NLPC_P60 [PF00877], Evalue: 0.00092, Aligned region: 23..100
Protein Sequence: 156 a.a.     [Download]
>gi|152987248|ref|YP_001348808.1| hypothetical protein PSPA7_3448 [Pseudomonas aeruginosa PA7]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVAMPRGNANAMVDGLAQHQGWSRLASGA
EAAQKAAQGYLVIAGLKGRTYGHVAVVISGPLYRQKYPLCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRL
DYYVYSLASCSLPKAS
-
Nucleotide Sequence: 471 bp     [Download]
>gi|152983466|ref|NC_009656.1|:3574266-3574736 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAACTCGGTGTGGCGATGCCGCG
CGGCAATGCCAACGCCATGGTCGACGGCCTGGCGCAGCACCAGGGCTGGAGCAGGCTCGCCTCCGGCGCC
GAGGCCGCGCAGAAGGCCGCCCAGGGTTACCTGGTGATCGCCGGCCTAAAGGGCCGCACCTACGGCCACG
TGGCGGTGGTCATCAGCGGCCCGCTGTATCGGCAGAAGTACCCGCTGTGCTGGTGCGGCAGCATCGCCGG
CGCGGTCGGCCAGAGCCAGGGGCTGAAATCGGTCGGCCAGGTGTGGAACCGTACCGACCGCGACCGCCTC
GACTACTACGTCTACTCCCTGGCCAGCTGCAGCCTGCCCAAGGCCAGTTGA
 Primer design