SecReT6
Effector Protein ID: 152995211
SecReT6 ID216
T6SS typeA1
Gene symbol-
Locus tagMmwyl1_1182
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1318734..1319252 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDA6VUI2
KEGG IDmmw:Mmwyl1_1182, mmw:Mmwyl1_1211
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-35, Aligned region: 8..155
Protein Sequence: 172 a.a.     [Download]
>gi|152995211|ref|YP_001340046.1| hypothetical protein Mmwyl1_1182 [Marinomonas sp. MWYL1]
MPTPCFISIEGESQGLITAGAMTVDSIGDVGLEGHDDEMLVQRFDHNVTVPTNPQSGNPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLPKVELKWYRTSAEGKQENFFVTALEGAVIVDIHCEMPHCQDPAMGNFTQ
NLTVSMAYRKITWDHINSGTSGSDDWSKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1318734-1319252 Marinomonas sp. MWYL1 chromosome, complete genome
ATGCCAACGCCATGTTTTATCTCGATCGAAGGGGAATCTCAGGGTCTTATCACTGCCGGTGCCATGACAG
TCGATTCTATCGGTGACGTAGGCTTGGAAGGTCATGATGACGAAATGCTGGTGCAACGCTTTGACCACAA
CGTCACTGTACCGACTAACCCACAGTCTGGTAACCCATCTGGTCAACGCGTACACAAGCCATTCAAATTC
ACCGTTGCTTTGAACAAAGCGGTTCCACTGCTTTACAACGCCTTGTCTTCTGGTGAAAAACTGCCAAAAG
TAGAATTGAAATGGTACCGCACGTCTGCAGAAGGCAAGCAAGAGAACTTCTTCGTTACCGCACTAGAAGG
CGCGGTCATCGTGGACATCCATTGCGAAATGCCACATTGCCAAGACCCAGCGATGGGCAACTTCACACAG
AACCTAACGGTCTCTATGGCTTACCGTAAGATCACTTGGGATCACATCAACTCTGGTACGTCTGGTTCTG
ACGACTGGAGCAAGCCAATCGAAGCGTAA
 Primer design