SecReT6
Effector Protein ID: 156936040
SecReT6 ID227
T6SS typeA3
Gene symbol-
Locus tagESA_03934
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3884614..3885096 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDA7MQ13
KEGG IDesa:ESA_03934
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.90E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|156936040|ref|YP_001439956.1| hypothetical protein ESA_03934 [Cronobacter sakazakii ATCC BAA-894]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTA
TGGKGAETSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3885096-3884614 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGCTATTGATATGTTCCTGAAAGTAGACGGTGTAACCGGCGAATCTAAAGATTCCAACCACACCGGCT
GGACCGACATCACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGAATTTCAACGATCTGCACGTTAACGCGCTGATCGACAAATCCACCACCGCTATCCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCGGGCGGCCAGCAGG
TGGAATACACCCGTATCACCCTGGAAGACGTGCTGGTGACTTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTTGGCGTTACTTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTGCG
ACCGGCGGCAAAGGCGCAGAAACCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA
 Primer design