SecReT6
Effector Protein ID: 167033775
SecReT6 ID252
T6SS typeA4b
Gene symbol-
Locus tagPputGB1_2776
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3118706..3119224 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorPsyr_4965
DescriptionHcp protein
UniProt IDB0KU07
KEGG IDppg:PputGB1_2776
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|167033775|ref|YP_001669006.1| unnamed protein product [Pseudomonas putida GB-1]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFIAGGNQGGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3118706-3119224 Pseudomonas putida GB-1 chromosome, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGCGAAGTACTGGATGAAAAACACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCAACCTCGGCTACCGCCAGCTCCTCGGGTGG
TGCGTCTTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCCGTCGACAAGGCTTCGGCCAAG
CTGTTCGAGCACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGCG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTGTCGTCGGTCAAGTTCATCGCCGGTGG
CAATCAAGGCGGTGAAGACAAGGCGGTCAGCGACCTGCCTGTAGAAGAAATCAGCTTCAACTTTGCCCGT
ATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCCGGCGGCAACATCGTCGGTGGCTGGG
ACCGTACCGCGAACAAAGTGTTCGCCTAA
 Primer design