SecReT6
Effector Protein ID: 167034230
SecReT6 ID253
T6SS typeA1
Gene symbol-
Locus tagPputGB1_3233
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3621473..3621988 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDB0KHP3
KEGG IDppg:PputGB1_3233
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.70E-36, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|167034230|ref|YP_001669461.1| unnamed protein product [Pseudomonas putida GB-1]
MPTPAYIKIEGKTQGNITAGAFTSDSVGNVFVEGHEDEILVQEIKHQVTVPTDPQSGQPAGQRVHKPFIF
TSSLNKATPLMYQALASGEMLPVVEVNWYRTSVEGKQEHFFTTKLEDATIVDINTTLPHAQDQTNANYTQ
LIEVAMSYRKISWAHVTAGTEGSDDWRKPIA
-
Nucleotide Sequence: 516 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3621473-3621988 Pseudomonas putida GB-1 chromosome, complete genome
ATGCCAACCCCCGCTTACATCAAGATCGAAGGCAAGACCCAAGGCAACATCACCGCAGGCGCATTCACCT
CCGACTCAGTCGGCAATGTATTCGTCGAAGGCCACGAAGACGAGATTCTGGTGCAGGAGATCAAGCACCA
GGTGACCGTTCCCACCGATCCGCAAAGTGGCCAGCCTGCTGGCCAAAGGGTGCACAAGCCCTTCATTTTC
ACCAGCTCACTAAACAAAGCCACACCATTGATGTACCAGGCGCTGGCCAGCGGCGAAATGCTGCCAGTCG
TTGAAGTGAACTGGTACCGCACCTCGGTGGAGGGGAAGCAAGAGCATTTCTTCACCACCAAGCTGGAGGA
CGCCACCATCGTGGACATCAATACCACCTTGCCGCATGCCCAAGACCAGACAAACGCTAACTATACGCAG
TTGATCGAAGTGGCAATGTCATACCGCAAGATTTCCTGGGCCCACGTGACGGCGGGTACGGAAGGCTCCG
ACGACTGGCGCAAACCGATCGCCTGA
 Primer design