SecReT6
Effector Protein ID: 16765702
SecReT6 ID23
T6SS typeA3
Gene symbol-
Locus tagSTM2375
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconchromosome [GenBank: NC_003197] [Browse all T6SS(s) in this replicon]
Location [Strand]2486915..2487283 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDQ8ZNB5
KEGG IDstm:STM2375
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.00011, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|16765702|ref|NP_461317.1| hypothetical protein STM2375 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|16763390|ref|NC_003197.1|:2486915-2487283 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
ATGAGTTGGGATAAAAGAATGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA
 Primer design