SecReT6
Effector Protein ID: 170726860
SecReT6 ID263
T6SS typeA1
Gene symbol-
Locus tagSwoo_2514
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3070518..3071036 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDB1KGS2
KEGG IDswd:Swoo_2514
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.20E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|170726860|ref|YP_001760886.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MPTPCYISIKGQTQGDITAGAFTADSVGDIFVEGHEDEMLVQEFDHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNSLASGEKITEVELKWYRTSVEGKQEHYFSTKLEGATIIDIQCQMPHCQDPNKSDFTQ
LVTVSMAYRKIDWDHTVAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3071036-3070518 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGCCAACACCATGTTATATCTCAATCAAAGGACAGACTCAGGGCGATATCACTGCGGGCGCGTTTACTG
CTGATTCTGTCGGTGACATTTTTGTCGAAGGCCATGAAGATGAGATGCTGGTTCAAGAGTTTGATCATAT
CGTGACTGTGCCGACAGACCCTCAATCTGGACAACCATCTGGCCAGCGTGTGCACAAACCATTTAAGTTT
ACCGTTGCGCTAAACAAAGCAGTGCCATTGATGTACAACTCTTTAGCTTCAGGTGAGAAGATCACTGAAG
TTGAACTCAAGTGGTACCGCACTTCAGTTGAAGGTAAGCAGGAGCATTACTTCAGTACTAAGTTAGAGGG
CGCGACGATCATCGATATTCAATGTCAGATGCCGCACTGTCAAGATCCTAATAAATCTGATTTTACTCAG
CTGGTTACTGTGTCTATGGCTTACCGTAAAATCGACTGGGATCATACCGTTGCTGGTACTTCTGGTTCTG
ATGACTGGCGTAAGCCGATCGAAGCATAA
 Primer design