SecReT6
Effector Protein ID: 172062677
SecReT6 ID270
T6SS typeA2
Gene symbol-
Locus tagBamMC406_3645
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]591574..592059 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDB1Z0J1
KEGG IDbac:BamMC406_3645
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|172062677|ref|YP_001810328.1| Hcp1 family type VI secretion system effector [Burkholderia ambifaria MC40-6]
MAIPAYMWLKDDGGADIKGSVTVQDREGSVELVAFDHGVHIPTDGNTGKLTGTRVHKPITLTKETDASTP
YLYKAVTSGQTLKSVEIKWYRIDDAGKEKEYFNTKLDNVKIVAVKPKMLDIKNPDYEKHNHLEDVELRYE
TITWSYKDGNIIHKDTWNERS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c592059-591574 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGGCAATTCCGGCCTACATGTGGCTCAAGGACGACGGTGGCGCGGACATCAAGGGTTCGGTAACCGTCC
AGGATCGCGAGGGTAGCGTCGAACTGGTCGCGTTCGATCATGGCGTGCACATTCCGACCGACGGCAATAC
GGGCAAGCTGACCGGCACGCGCGTGCACAAGCCGATCACGCTGACGAAGGAGACCGACGCGTCGACGCCG
TACCTGTACAAGGCCGTGACGAGCGGCCAGACGCTGAAGTCGGTCGAGATCAAGTGGTATCGAATCGACG
ACGCGGGCAAGGAAAAGGAATACTTCAACACCAAGCTCGACAACGTGAAGATCGTCGCGGTGAAGCCGAA
GATGCTCGACATCAAGAACCCCGACTACGAGAAGCACAACCATCTCGAAGACGTGGAACTGCGTTACGAG
ACGATCACGTGGTCGTACAAGGACGGCAACATCATCCACAAGGACACCTGGAACGAACGTTCCTGA
 Primer design