SecReT6
Effector Protein ID: 194291774
SecReT6 ID267
T6SS typeA4b
Gene symbol-
Locus tagRALTA_B1015
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1059019..1059522 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDB3R9P9
KEGG IDcti:RALTA_B1015
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|194291774|ref|YP_002007681.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MKDIYVKFGSPAIKGESQDKDHKDWIEVNTWKHSITQPRSATASTAGGHTAERCEHGEMVFTKDLDVVSP
LLYQHVSGGTTFDEVTIDFLRADGEGKRVKYLEIKLKNAILGAVSANVVAEGIPSDSFTLKYAAVQWKYT
QQKIGGNQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1059019-1059522 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGAAGGATATCTACGTCAAGTTCGGCAGCCCGGCAATCAAGGGCGAATCGCAAGACAAGGACCACAAGG
ACTGGATCGAGGTCAACACCTGGAAGCACAGCATCACGCAGCCACGTTCGGCAACCGCGTCGACCGCTGG
CGGCCATACCGCAGAGCGTTGCGAGCACGGCGAGATGGTGTTCACCAAGGATCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGTGTCGGGCGGCACCACGTTCGACGAAGTCACCATCGACTTCCTGCGTGCCGACG
GTGAAGGCAAGCGGGTCAAGTACCTGGAAATCAAGCTGAAGAACGCCATCCTGGGTGCGGTGTCGGCCAA
CGTGGTTGCCGAGGGCATCCCCAGCGACAGCTTCACGCTGAAGTACGCTGCCGTGCAGTGGAAGTACACG
CAGCAGAAGATCGGTGGCAACCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTCTGA
 Primer design