SecReT6
Effector Protein ID: 197247521
SecReT6 ID298
T6SS typeA1
Gene symbol-
Locus tagSeAg_B1113
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1113950..1114468 [+]
Producthcp
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDB5F2N5
KEGG IDsea:SeAg_B1113
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-35, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.004, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|197247521|ref|YP_002146021.1| hcp [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197247352|ref|NC_011149.1|:1113950-1114468 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGCCAACACCGTGTTACATCTCAATTACGGGGCAAACCCAGGGCAATATCACCGCTGGTGCATTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGTCACGAGGATGAAATGCTGGTACAGGAATTCCTGCATAA
CGTGACCGTACCCACCGATCCACAGTCCGGGCAGCCGAGCGGCCAGCGTTCGCACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCCGTACCGCTGCTGTACAACGCGCTGGCGTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAGCATTACTTCACCACCCGCCTGACGGA
CTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGGACCCGGCAAAGCGCGAATTCACGCAG
TTGCTCGAAGTCTCGCTGGCCTACCGCAAAATCGAGTGGGAACACGTCAAATCCGGCACCTCTGGCGCGG
ATGACTGGCGCGCGCCGCTGGAAGCGTAA
 Primer design