SecReT6
Effector Protein ID: 197249817
SecReT6 ID298
T6SS typeA1
Gene symbol-
Locus tagSeAg_B3302
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]3207255..3207740 [-]
Productcytoplasmic protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDB5F5R1
KEGG IDsea:SeAg_B3302
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|197249817|ref|YP_002148050.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MDAIFLKLDNIKGESQVGGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKP
DGAQQESRTSVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c3207740-3207255 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGGAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAACCA
GACGGCGCTCAACAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA
 Primer design