SecReT6
Effector Protein ID: 197335173
SecReT6 ID299
T6SS typeA1
Gene symbol-
Locus tagVFMJ11_1495
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1580072..1580590 [-]
ProductBfdA
Effector typeProtein
Homologous effectorVEPGS_0021
DescriptionHcp protein
UniProt IDB5FEE9
KEGG IDvfm:VFMJ11_1495
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|197335173|ref|YP_002156214.1| BfdA [Vibrio fischeri MJ11]
MPTPAYMSIKGETQGDITKDAYSADSVGNVWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPVVV
TKQQDRCSPLLFNALVSGEKLPECSINFYRTSTSGKQEHYYTIKLIDALLVDMQTRMAHCQDAAMADRVT
EEVLKFTYRAIEVTHETCGTAGNDDWRTPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1580590-1580072 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGCCAACTCCAGCTTATATGTCAATTAAAGGTGAAACTCAAGGCGATATCACTAAAGATGCTTACTCAG
CAGATTCAGTAGGTAACGTATGGCAAGAAGCACACGTTGATGAATTTCTTGTTCAAGAACTTGATCACGT
ATTAACGGTTCCACGTGATCCACAAAGCGGCCAACCAACAGGTCAACGCGTTCACCGTCCAGTAGTCGTA
ACTAAGCAACAAGACCGTTGTTCTCCACTACTATTCAATGCTCTTGTATCTGGTGAAAAACTGCCTGAGT
GTAGCATCAACTTCTACCGCACTTCGACTTCAGGTAAGCAAGAGCATTACTACACAATTAAACTGATTGA
TGCACTACTAGTTGATATGCAAACTCGCATGGCTCACTGTCAAGATGCAGCAATGGCTGATCGTGTAACA
GAAGAAGTGCTTAAGTTTACTTACCGTGCAATTGAAGTGACTCACGAAACATGCGGTACAGCAGGTAATG
ACGACTGGCGCACACCGCGCGAAGCGTAA
 Primer design