SecReT6
Effector Protein ID: 205353488
SecReT6 ID303
T6SS typeA1
Gene symbol-
Locus tagSG2405
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]2471848..2472216 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDB5RCK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.0001, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|205353488|ref|YP_002227289.1| hypothetical protein SG2405 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|205351346|ref|NC_011274.1|:2471848-2472216 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACGTATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA
 Primer design