SecReT6
Effector Protein ID: 229593386
SecReT6 ID482
T6SS typeA3
Gene symbol-
Locus tagPFLU6021
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6582126..6582614 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDC3K4A9
KEGG IDpfs:PFLU6021
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.70E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|229593386|ref|YP_002875505.1| hypothetical protein PFLU6021 [Pseudomonas fluorescens SBW25]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMAQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMVINLEEVLVTSLSTGGSGGDDRLTENVTLNFAQVMVDYQPQK
ADGTKDGGAIKFGWNIRSNTKR
-
Nucleotide Sequence: 489 bp     [Download]
>ref|NC_012660.1|:6582126-6582614 hypothetical protein PFLU6021 [Pseudomonas fluorescens SBW25]
ATGGCTGTTGATATTTTCATCAAGATCGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAAGACG
AGATCGACGTGCTGAACTGGAGCTGGGGCATGGCCCAGTCCGGCAACATGCACGTGGGCGGTGGCGGCGG
CGCGGGCAAGGTGAATATCCAGGACCTGTCGCTGACCAAGTACGTCGACAAGGCTTCGCCGAACCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGCGGTGAAAGCC
AGGTCGAGTACATGGTGATCAACCTGGAAGAAGTGCTGGTCACCTCGCTGAGCACCGGCGGTTCGGGTGG
CGATGACCGCCTGACCGAAAACGTCACCCTGAACTTTGCCCAAGTGATGGTCGACTACCAGCCGCAGAAA
GCCGACGGCACCAAAGACGGCGGCGCGATCAAGTTTGGCTGGAACATCCGTTCCAACACCAAGCGCTGA
 Primer design