SecReT6
Effector Protein ID: 229593391
SecReT6 ID482
T6SS typeA3
Gene symbol-
Locus tagPFLU6026
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6588899..6590839 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDC3K4B4
KEGG IDpfs:PFLU6026
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-88, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0013, Aligned region: 514..536
Gp5_C [PF06715], Evalue: 0.0013, Aligned region: 529..545
Protein Sequence: 646 a.a.     [Download]
>gi|229593391|ref|YP_002875510.1| hypothetical protein PFLU6026 [Pseudomonas fluorescens SBW25]
MLFNQASRLAKITSPLGPDVLLLNEMGGGEELGRLFNYELQLTSLDANIDLNQLLGKPMSVGLQLADGGE
RHFHGIVARCSQNIDQGQFASYQVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQDRHVLVLADAYGAHTTVPGYASIPYYPKDEQQRER
DHMHNWHLAQEVQPGSLELNDYDFQRPSASIDVRSAMPRPHTAGDYPLYDYPGTYVQSADGEHYARTRIE
ALQTLHEQIEFSGNARGLGSGHLFSLTGFSRQDQNREYLIVGIRYYIVQESLESGGGSGGAQFESSLTCI
DAQQSFRPLASTHRPIVKGPQTALVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQSWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIVTGRVYNAEQTVPYDLPENATQSGMKSRSSKGGTPANFNEIRM
EDKKGLEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHDETVTIGNNRTRIVKQEDVLVVGQRKTDSIS
QSYVIEVGENLRLVCGESILELNASGQINLTGVNISFYASGDAEFNTKGVLHLNNGNGPGASPEGQGIKK
SIDANVKASFPPPKSS
-
Nucleotide Sequence: 1941 bp     [Download]
>ref|NC_012660.1|:6588899-6590839 hypothetical protein PFLU6026 [Pseudomonas fluorescens SBW25]
ATGCTTTTTAACCAAGCCTCACGCCTGGCCAAGATCACCAGCCCCCTGGGGCCGGATGTGCTGCTGCTCA
ATGAAATGGGCGGCGGCGAAGAGCTGGGGCGGCTGTTCAACTATGAGCTGCAACTGACGTCCCTGGACGC
CAACATCGACCTCAACCAGTTGCTCGGCAAACCCATGAGCGTGGGCCTGCAACTGGCGGACGGCGGTGAG
CGGCACTTCCACGGTATCGTCGCGCGCTGCAGCCAGAACATCGACCAGGGCCAGTTCGCCAGTTACCAGG
TGACGTTGCGCCCGTGGCTGTGGCTGCTCAGCCGTACCTCGGACTGCCGGATTTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTCCGCGACCTGGGGTTTTCCGACTTCGAAGACGCCCTGAGCCGGCCG
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGCTTGATGGAAC
AGGAAGGCATCTACTACTTCTTCCGCCATGAACAGGACCGCCATGTGCTGGTGCTGGCTGACGCCTACGG
TGCCCACACCACCGTGCCGGGCTACGCATCCATCCCGTATTACCCCAAGGACGAGCAGCAGCGCGAACGC
GACCACATGCACAACTGGCACCTGGCGCAAGAGGTGCAGCCCGGCTCGCTGGAGCTCAACGACTACGACT
TCCAGCGCCCCAGCGCGAGCATCGACGTGCGCTCGGCCATGCCGCGCCCGCACACCGCCGGCGACTACCC
GCTGTACGACTACCCCGGCACCTACGTGCAAAGCGCCGACGGCGAACACTACGCCCGCACCCGCATCGAA
GCCCTGCAGACCCTGCATGAACAGATCGAGTTCAGCGGCAACGCGCGTGGCCTGGGTTCGGGGCATTTGT
TCAGCCTCACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATCGTCGGCATTCGCTATTACAT
CGTCCAGGAAAGCCTGGAAAGCGGCGGCGGTTCGGGCGGCGCGCAGTTCGAAAGCAGCCTGACCTGCATC
GACGCCCAGCAGAGCTTCCGCCCGTTGGCCAGCACCCACCGCCCTATCGTCAAAGGCCCGCAGACCGCGC
TGGTGGTCGGGCCCAAGGGCGAGGAAATCTGGACCGACCAGTATGGCCGCGTGAAGGTGCACTTCTACTG
GGACCGCCACGACCAATCCAACGAGAACAGCTCCTGCTGGATTCGTGTGTCGCAATCCTGGGCCGGCAAG
AACTGGGGCTCGATGCAGATTCCCCGGATCGGCCAGGAAGTGATTGTGAGCTTCCTTGAAGGTGACCCCG
ACCGGCCGATCGTCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGACCTGCCGGAGAACGC
TACCCAGAGCGGTATGAAGAGTCGATCCAGCAAGGGCGGCACGCCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAGGGGTTGGAGCAGTTGTATATCCATGCTGAGCGGAATCAGGACATTGTCGTCGAAGTCG
ACGAAAGCCATTCCGTGGGGCATGACCGGAATAAGAGCATTGGGCATGACGAGACGGTGACCATCGGCAA
TAACCGTACGCGCATCGTCAAACAGGAGGATGTGCTCGTAGTAGGCCAGCGCAAGACCGACAGCATCAGC
CAGAGCTATGTGATCGAAGTGGGTGAAAACCTGCGACTGGTGTGCGGCGAAAGCATCCTGGAGTTGAACG
CCAGCGGGCAGATCAACCTCACCGGGGTGAACATCAGTTTTTATGCCAGCGGTGATGCCGAGTTCAACAC
CAAGGGCGTACTGCATCTGAACAATGGCAACGGCCCGGGTGCCAGCCCCGAGGGCCAAGGCATCAAAAAA
AGCATCGACGCGAATGTCAAAGCCTCCTTCCCCCCGCCTAAAAGCTCCTGA
 Primer design