SecReT6
Effector Protein ID: 241664838
SecReT6 ID349
T6SS typeA3
Gene symbol-
Locus tagRpic12D_3260
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]3440567..3440926 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorRpic12D_3260
DescriptionTae3_RP
UniProt IDC6BHF2
KEGG IDrpf:Rpic12D_3260
PDB ID4HZ9, 4HZB
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 9.00E-05, Aligned region: 8..84
NLPC_P60 [PF00877], Evalue: 0.00061, Aligned region: 23..90
Protein Sequence: 119 a.a.     [Download]
>gi|241664838|ref|YP_002983198.1| hypothetical protein Rpic12D_3260 [Ralstonia pickettii 12D]
MYKGISAANYAASNIEPNSVGRCAEYVRKAIEWGGISLQRTRSAKDYGPSLLAAGFHEAIGSPMKGDVIV
IQPAPGHPHGHMAIYDGSHWISDFKQLHGFYPGPAYRSAKPAYKTYRYH
-
Nucleotide Sequence: 360 bp     [Download]
>gi|241661625|ref|NC_012856.1|:3440567-3440926 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTATAAGGGCATCTCAGCTGCAAACTATGCAGCAAGCAATATCGAGCCGAATAGTGTGGGCCGCTGCG
CAGAATACGTGCGCAAGGCGATTGAATGGGGCGGTATTTCTTTGCAGCGCACCCGCTCGGCAAAGGACTA
CGGCCCATCATTGCTGGCCGCCGGGTTCCATGAGGCGATAGGCTCGCCGATGAAGGGAGACGTGATCGTG
ATTCAACCCGCCCCCGGGCACCCTCACGGACACATGGCGATCTACGATGGCTCCCACTGGATATCAGACT
TCAAGCAGCTTCATGGTTTCTATCCTGGCCCGGCGTACAGAAGCGCCAAACCGGCCTACAAGACCTACCG
TTATCACTGA
 Primer design

Reference
(1) Dong C et al. (2013). Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3. Biochem J. 454(1):59-68. [PudMed:23730712] experimental in_silico
(2) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature