SecReT6
Effector Protein ID: 253987772
SecReT6 ID355
T6SS typeA1
Gene symbol-
Locus tagPAU_00289
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]321454..321972 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDB6VM89
KEGG IDpay:PAU_00289
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|253987772|ref|YP_003039128.1| hypothetical protein PAU_00289 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MPTPCYISITGKTQGNITAGSFTAESVGNIFVQGHEDEMLVQEFDHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKSVPLLYNALASGEMLTKVELKWYRTSVEGKQEHFFTTQLEDATIIDIDCKMPHCQDPTKSEFTQ
LVRVSLSYRKITWEHTTAGTSGADDWRAPIVA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|253987483|ref|NC_012962.1|:321454-321972 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCCAACTCCATGTTATATTTCCATCACTGGAAAAACCCAGGGCAATATTACTGCTGGCTCATTCACTG
CTGAATCAGTGGGTAATATTTTCGTTCAGGGACACGAGGATGAAATGCTGGTTCAGGAATTTGACCACGT
AGTTACTGTACCAACTGATCCTCAATCTGGTCAGCCTTCGGGTCAGCGTGCTCATAAACCATTCCGTTTC
ACAGTTGCATTAAATAAATCTGTTCCACTGCTTTATAATGCATTGGCTTCTGGTGAAATGTTGACAAAAG
TGGAATTGAAATGGTACCGCACTTCTGTTGAAGGAAAACAAGAGCATTTCTTCACTACTCAGTTGGAAGA
TGCCACTATTATCGACATTGATTGTAAAATGCCACATTGTCAGGACCCAACAAAATCTGAATTTACTCAG
TTAGTTCGTGTTTCTTTGTCTTATCGTAAGATTACTTGGGAACATACAACTGCGGGTACTTCTGGTGCAG
ATGACTGGCGCGCACCTATTGTTGCCTGA
 Primer design