SecReT6
Effector Protein ID: 260845465
SecReT6 ID366
T6SS typeA2
Gene symbol-
Locus tagECO103_3362
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3421024..3421515 [+]
ProductHcp-like protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDC8UAF1
KEGG IDeoh:ECO103_3362
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|260845465|ref|YP_003223243.1| Hcp-like protein [Escherichia coli O103:H2 str. 12009]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFIFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3421024-3421515 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACTCGCACCCATAAACCGTTCATTTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGTCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ACGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAA
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA
 Primer design