SecReT6
Effector Protein ID: 26990782
SecReT6 ID15
T6SS typeA1
Gene symbolhcp-2
Locus tagPP_4082
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4610520..4611035 [+]
Producthcp protein
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDQ88FK8
KEGG IDppu:PP_4082
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|26990782|ref|NP_746207.1| hcp-2 gene product [Pseudomonas putida KT2440]
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIF
TSSLNKATPLMYQALATGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQ
LVEVSLAYRKITWAHDVANTEGSDDWRAPAA
-
Nucleotide Sequence: 516 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4610520-4611035 Pseudomonas putida KT2440 chromosome, complete genome
ATGCCAACACCCGCTTACATCAAGATCGTAGGCCAGACCCAAGGCAACATCACCGCTGGCGCCTTCACCG
CTGACTCCGTCGGCAACGTGTTCCAACAAGGCCATGAAGATCAGATTCTGGTTCAGGAAATCAAGCATGA
GGTGACTACGCCCACTGACCCCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTC
ACCAGTTCACTGAACAAAGCTACCCCCCTGATGTATCAGGCACTTGCCACCGGCGAAATGCTGCCAACAG
TCGAGGTCAGCTGGTATCGCACCTCCTCGGAAGGCAAACAAGAGCATTTTTTCACCACCACGCTCGAAGA
CGCCACCATCGTCAGCATCAATACCGTGCTTCCCCACGCACTCGACAAAGACAATGAAAACTACACCCAG
CTGGTTGAAGTATCGCTGGCGTATCGAAAGATCACGTGGGCTCACGATGTAGCCAATACCGAAGGCTCTG
ACGACTGGCGCGCACCCGCCGCCTGA
 Primer design