SecReT6
Effector Protein ID: 291616629
SecReT6 ID384
T6SS typeA3
Gene symbolrhsD
Locus tagPANA_1076
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]1226493..1230686 [-]
ProductRhsD
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDD4GLX3
KEGG IDpam:PANA_1076
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 367..394
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 421..442
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 509..525
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 549..569
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 597..629
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 657..693
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 720..755
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 741..777
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 808..824
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 864..897
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 982..1006
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 998..1028
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 1074..1105
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 1134..1144
RHS_repeat [PF05593], Evalue: 5.10E-41, Aligned region: 1174..1188
Tox-HNH-EHHH [PF15657], Evalue: 1.20E-23, Aligned region: 1328..1396
PAAR_motif [PF05488], Evalue: 2.20E-16, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 2.20E-16, Aligned region: 83..155
RHS [PF03527], Evalue: 1.30E-13, Aligned region: 723..752
RHS [PF03527], Evalue: 1.30E-13, Aligned region: 760..770
RHS [PF03527], Evalue: 1.30E-13, Aligned region: 1053..1064
RHS [PF03527], Evalue: 1.30E-13, Aligned region: 1095..1102
RHS [PF03527], Evalue: 1.30E-13, Aligned region: 1165..1202
DUF4595 [PF15283], Evalue: 1.60E-05, Aligned region: 375..402
DUF4595 [PF15283], Evalue: 1.60E-05, Aligned region: 418..445
DUF4595 [PF15283], Evalue: 1.60E-05, Aligned region: 605..680
DUF4595 [PF15283], Evalue: 1.60E-05, Aligned region: 857..872
DUF4595 [PF15283], Evalue: 1.60E-05, Aligned region: 996..1089
DUF4150 [PF13665], Evalue: 0.0017, Aligned region: 83..111
DUF4150 [PF13665], Evalue: 0.0017, Aligned region: 120..155
Protein Sequence: 1397 a.a.     [Download]
>gi|291616629|ref|YP_003519371.1| RhsD [Pantoea ananatis LMG 20103]
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGLSIGVGYLTGE
LATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDDGPQQMAEGSSRVYINGLPAS
RIDDRTTCDAKVMTGSDNVYIGGEPEQTLPIQPEVPEWVYKASDLTLLFAGLAGGVGGAAGKVGALGKLL
SKIPGINKIARVACRAGALMTGVAAAGILARPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPG
DSVLGRGWNLFWETRLERYQDGLVWRAPSGDYVSFPLVPKGQRTYCEAEKHWLEHHRDDSWSLYDISGER
WHFMPLRDDAPSLPLCLTEPCGNEIQFDWNSDHTLAALTDSAGQRVTCRYANNRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWCDGLMVAHEDMNGLLSEYRWQEIDGLPRVVAFRHSGGEQLDFEYDFD
NGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYCAGELCDVIMPGGAMRCSNWDRYGRMTQEID
PVGRRTTYHWFRMTDRVIRTDYPDLSATQAAYDLNVRLLTETDALNNVTTYHYPDDTELLPDSITDATGG
VVKLEWNRQGLLTQRTDCSGSVTTFSYDRFGQLVRSVDAEGHVTQREWNDKGQLCAIIHPDGSRETLHWN
TQGQLSAWRDPLETEVRWTYNALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLS
EIRPDKTSRNMEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEDDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQLAWLHYGSGH
VSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELHSEVVLPEKAILERAFRYSAR
SELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFTYDNADNLAANDDALHALPVTDNRVHHWQNL
FMKYDDWGNLVSRRSGLHEQHFTYDAENRLISAKGNGPDGGFTAHYHYDALGRRTCKVVSTQHDRKEVRF
LWQGYRLLQEQQDNGQCQTYVYDPNEAWSPLARIDHMAAGGRGDVLWFNTDINGAPLEVTDERGNIRWSG
QYGSFGEVRRQTEGFTRLAKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWVDPLGLSNCGAPNKKTSYEGISRRDAFRQAKRDAGIPMNQHPSSITRPDLLDGSGKKIL
DSTGQPIKTRQYEFVDKRGQSVFLQEHSLGHTKATSGHGAEPHFNLRPLDNLNTGSVPGTHGHYNFP
-
Nucleotide Sequence: 4194 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c1230686-1226493 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGTTTGAAGCTGCACGCCTCGGCGATGATATCGGTCACTCTCATGCCCTGGCGGGCATGATTGCAGGCA
CTATCGTCGGTGGACTGATCGCTGCGGCGGGCGGTATTGCTGCGGGTGCATTGATGATTGCCGGGATAGG
CGCCTCCTGCCTTGGCGTGGGCGTATTGCTGGTTGGACTCAGTATCGGCGTGGGTTACCTTACTGGCGAA
CTGGCCACCGCCGCGCGAGACGGAATAGCGGATGCTGGGGCGGCCAGCATGACCCCAAAGGGCAAGATTA
CCACCGGTTCGCCCAACGTCTTTATTAACAGTAAACCCGCCGCCATGGCCACCAACAGCATAGTGGCATG
CAAGGACGATGGTCCGCAGCAGATGGCAGAAGGCTCCTCCCGGGTGTACATCAACGGCCTGCCTGCATCA
CGCATTGACGATCGCACCACCTGCGATGCCAAAGTGATGACGGGTTCTGACAACGTCTATATCGGCGGCG
AGCCTGAACAAACGCTGCCTATCCAACCTGAAGTGCCCGAATGGGTTTATAAAGCCTCCGATCTTACCCT
GCTGTTTGCCGGGCTGGCCGGTGGCGTGGGCGGTGCGGCTGGCAAGGTCGGCGCGCTGGGTAAATTACTG
AGCAAGATTCCCGGCATCAATAAAATCGCCCGGGTGGCCTGCCGTGCTGGTGCCTTAATGACCGGTGTGG
CGGCCGCAGGTATTCTTGCCCGTCCCGTTGATATCGTAAGCGGCCAGAAGTTTCTTAGCGGCGATGATGA
ACTGGATTTTGTGCTGCCCTCCCGGCTGCCGCTACGCTGGCAGCGCTACTGGCGCAGCGGTAATCCCGGC
GACAGCGTATTAGGCCGTGGCTGGAACCTGTTCTGGGAAACACGGCTGGAACGCTACCAGGATGGGCTGG
TCTGGCGTGCGCCCTCCGGCGATTACGTCTCTTTTCCTCTGGTGCCCAAAGGCCAGCGTACCTACTGCGA
AGCGGAGAAACACTGGCTGGAACATCATCGGGACGACAGTTGGTCATTGTATGACATCAGCGGTGAGCGC
TGGCATTTTATGCCCCTGCGCGATGATGCCCCTTCTCTTCCCCTCTGCCTGACCGAGCCCTGCGGCAATG
AGATTCAGTTCGACTGGAACTCCGATCACACATTGGCCGCGCTGACAGACAGTGCCGGTCAGCGCGTAAC
CTGCCGCTATGCGAATAACCGGCTCGCAGGTGCCTGGCTGGATGACGATATTTGTCTGGTCAGTTACGCT
TATGATGATATCGGCCAACTCGTTACGGTAACGGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCAGTGGT
GCGATGGCCTGATGGTCGCCCATGAAGATATGAATGGCCTGCTAAGTGAGTATCGCTGGCAGGAGATCGA
TGGCCTCCCAAGAGTGGTGGCCTTCCGTCACAGCGGCGGCGAGCAGCTGGATTTTGAGTACGATTTTGAT
AATGGCATCCGACGCGCGCGACGTGATGACGGCGTTGAAGCTCACTGGCTCATTGACGATGACGATCATG
TCGCCCGCTTCACCGACTTCGACGGCCGCCAGACCATGCTGGTTTACTGCGCAGGCGAGTTGTGCGATGT
GATTATGCCCGGCGGCGCCATGCGCTGCAGCAACTGGGACCGCTATGGTCGCATGACGCAGGAGATCGAT
CCGGTCGGACGTCGAACCACTTATCACTGGTTCCGCATGACTGACCGTGTGATCCGTACGGACTATCCCG
ATCTGAGCGCGACTCAGGCGGCTTACGATCTTAATGTTCGCCTGCTGACTGAAACCGATGCGCTCAATAA
CGTCACCACCTATCACTACCCTGATGACACAGAACTGCTGCCAGACAGCATCACCGATGCAACGGGCGGC
GTGGTGAAGCTGGAATGGAACCGACAAGGGCTGCTGACGCAGCGCACCGACTGCTCTGGCAGCGTAACGA
CGTTTAGCTACGACCGATTTGGCCAGCTTGTTCGCAGCGTGGATGCTGAAGGTCATGTCACCCAGCGCGA
GTGGAATGACAAGGGACAACTCTGCGCCATTATCCATCCAGACGGCAGCCGGGAAACCCTGCACTGGAAC
ACCCAGGGGCAGCTCAGTGCGTGGCGCGATCCGCTGGAGACCGAAGTCCGCTGGACCTATAACGCACTCG
GATTACCGGTGAGCCTGACGGACCGCATTGGTCGCACGCGTCGCTGGCATTACGATGCCCGTGGTAATCT
GCTGCGGCTGGAAAACGGCAACGGCGGTGACTATCGCTTTACCTGCGATCCGCTCGGCCGTCCATTGAGT
GAGATCCGGCCCGATAAGACCTCACGCAATATGGAATGGAATGCTCGTGGTTTTCTCATTGGTTTACAGG
AAAATGGCCAGCCCGCTAATGACGGTGGCATAGCCCGACGCTGGCAGCGCTTTAGCTACGACGACAGCGG
CTTGATTACCCAGCGCACAACGCAGCATGCAGAATACCACTACCGGCGTCATCGTAGCGGTCAACTTGCC
AGCCTGGTTCGCACGCCGACCAGTGACGGAATGGCGCTTGGTATCGAAGACGATGAAATCGCCTTTACCT
ATGACGTCGCAGGTCAGCTCTTAACAGAAGCCGGTATAAACGGGAAACTGGATTACGAATGGGATGCACT
GGGCAACCTCACCCATCTGACCCTGCCGGGTGAACAGCAACTTGCCTGGCTGCACTACGGTTCGGGTCAC
GTCAGCGCGATTCGCTTTAATCAGCAACTGGTCAGTGAATTTACCCGCGACCGCCTGCACCGGGAAATTC
GTCGCAGTCAGGGCGCGCGTGAGCAGGCGCGTCAGTACGACAGCCTTGGCAGGCGTACGATGCAGCGCAG
TGAATTGCATAGCGAGGTGGTGCTACCGGAAAAAGCCATTCTGGAACGCGCTTTCCGCTATTCGGCGCGC
AGTGAACTGGAGTCTGTCAGTGATACGCTGCGCGGCGACATTATCTATGGTTACGATGATGAAGGCCGCC
TGCTGAAGCACTACGAAGCCAGACAGGGCCACAGCACCTCGCATTTTACTTACGATAATGCGGACAACCT
GGCCGCCAACGACGATGCACTGCACGCGTTGCCGGTTACCGACAATCGAGTGCATCACTGGCAGAACCTG
TTTATGAAGTACGATGACTGGGGCAACCTGGTCAGTCGACGCAGCGGCCTGCATGAGCAGCATTTTACCT
ATGACGCCGAAAACCGGCTCATCAGCGCCAAAGGCAATGGCCCGGACGGCGGGTTTACCGCGCATTATCA
TTATGATGCGCTGGGCAGGCGCACCTGCAAAGTGGTCAGCACCCAGCACGATCGTAAAGAAGTCCGTTTT
CTGTGGCAGGGCTATCGCCTGTTACAGGAGCAACAGGATAATGGCCAGTGCCAGACCTATGTGTACGATC
CCAACGAGGCCTGGAGCCCGCTGGCGCGCATCGACCATATGGCAGCAGGCGGCCGGGGCGATGTGCTGTG
GTTTAACACCGATATTAACGGGGCACCGCTAGAGGTGACCGATGAACGGGGCAATATCCGCTGGAGCGGT
CAGTACGGCAGCTTTGGCGAGGTACGCCGACAGACGGAGGGCTTTACCCGGCTGGCAAAACAGTCTGCCC
TGCCCCATCAGCCGCTGCGCTATGCGGGCCAGTATGCGGACAGCGAAACCGGTCTACACTACAATCTGTT
TCGCTATTACGATCCGCAGGTGGGACGGTTTACGGTTCAGGACCCGATAGGGCTGGAAGGCGGCTGGAAC
CTTTATCAGTATGCGCCGAACCCGCTGAGCTGGGTGGATCCGCTGGGGTTGAGTAATTGCGGTGCTCCAA
ACAAAAAGACATCTTATGAAGGTATCAGTCGCAGAGATGCGTTTAGGCAAGCTAAAAGGGATGCTGGAAT
ACCAATGAATCAACATCCTAGCTCTATCACAAGACCCGACTTACTAGATGGGAGTGGTAAAAAAATATTA
GATAGTACTGGGCAGCCAATAAAAACTAGGCAATACGAATTTGTTGACAAAAGAGGTCAGTCCGTCTTTC
TACAAGAACATAGTTTAGGACATACCAAGGCTACTTCTGGTCATGGAGCTGAACCTCATTTTAATCTTAG
GCCTCTTGACAACTTGAATACCGGTTCAGTTCCTGGTACTCATGGTCACTATAATTTCCCATAA
 Primer design