SecReT6
Effector Protein ID: 291617901
SecReT6 ID384
T6SS typeA3
Gene symbolrhsD
Locus tagPANA_2348
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2611524..2615627 [-]
ProductRhsD
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDD4GHJ8
KEGG IDpam:PANA_2348
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 393..410
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 431..444
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 482..509
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 555..576
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 569..605
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 590..626
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 654..690
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 697..732
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 727..745
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 759..796
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 780..816
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 801..855
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 868..896
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 914..934
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 920..955
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 983..1010
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 1050..1063
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 1055..1087
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 1.50E-55, Aligned region: 1144..1163
PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 92..131
PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 176..218
RHS [PF03527], Evalue: 8.00E-12, Aligned region: 736..752
RHS [PF03527], Evalue: 8.00E-12, Aligned region: 932..946
RHS [PF03527], Evalue: 8.00E-12, Aligned region: 988..1008
RHS [PF03527], Evalue: 8.00E-12, Aligned region: 1116..1127
RHS [PF03527], Evalue: 8.00E-12, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 0.0016, Aligned region: 107..125
DUF4150 [PF13665], Evalue: 0.0016, Aligned region: 178..215
Protein Sequence: 1367 a.a.     [Download]
>gi|291617901|ref|YP_003520643.1| RhsD [Pantoea ananatis LMG 20103]
MDNRAARVGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATAAAPLLGAGMAAAGVAAIGSSCLLSGI
IGGVLANAAGISDDITKAADGLGDMIFPPSPAGVIASGSENVHVNGLLAARAAGMLTPGDTPPPEPQSPK
SFADYGGMLLSAVGQFGSAMWQPTVASADAGASPLEQDKVACEKHSAPQYLAQGSKSVFINGQPAVRAKD
KTTCDATVSDDVSPNVIIGGETVTVREIKSGKVPGLAVMMIGLSLIRGRPSQILKNMPCALAGAVGGMMA
DMAINAAFSSLFPVHASTGVKVLNDDAERDFSLPGRFPLSFQRSYNSLTQRSGLFGLGWATVFDSYITLD
GNQATWFDDNGRELSFAVPGEKEVLYSISEGLMVRRNELGDIAIADDDGAVWRLYRRTAADPQVLRLASL
SDEYGNALEMGWDEQARLVRIHDAPLAIDVTLHYDDKQHAQRPTSASHFDGEQHWPLTLWTYNEQGQLAS
VTDAAGVVSRRFRYNDDGLMIWHQLPGGLESEYRWQKLDHWRVVENRTNTGDGCHMHYDLDAGITRVSTY
DGQQREHHWNAAGLITCFIDERGETWRYEWDENELLTRRIDPLGNAVSFTYDYLGNRVEEKDADGGVQAV
QWLSHRSLPTVVAGADGATTKYYYDPHHGLERVVDALGQSTFYKRDEFGLVVEEIDAAGNSYRREFNDAG
QVIRETDCSGLTTRYRYHPLGWLSCVTAPDGEETRYHYDAAGRPVLLERAEGWEERLRWSDNGLPLSHES
ADGKRSDFRYDNVGRLIANRNAQGETVQRSWDSRGRLTALQNENGEQYQFEWGADSLLLAQVGLDGVATR
YEYDAAGRTLSRTFAAGHPQAITHRYHWSRAGQLLARTTPEGQTRYHYSGGGQLSKVSQHLPLSDTEWSQ
QAEQEIAFTYDALGRIVGEQGEQGALAWDYDALGNCTALTLPDGRNLKQLYYGSGHLLSIALDNLPVTEF
TRDTLHRELSRTQGGLTTRSEYDRLGRLRRRDVFKGEAQRPAPRVWSRRRDFDYGNNLIREERDDNPFSQ
TLWHYDNAGRLLSQEGAQPGNEQWRWDGAGNPLDRHAASHIMHNRVTELNGIRWQYDIHGRTTEKDDGQT
RWRYRYDGEHRLTDVISEPRDRNRPRTKVSFRYDPLGRRISKTRQQLLQGRPSGNAVTTRFVWEGYRLLQ
EIHDDIPLTYVYSDSQSYEPLARIDGVESPEIFWFHCAANGTPELLTDVEGQKTWEGVNSPWGKLLRESN
QRIPVVEQNLRMQGQYLDRETGLHYNLFRYYDPDSGRFTQHDPIGLAGGINLYQYAPNALGWVDPLGLMI
FNGRRKVHSLQGNRLVEHTMLQKGLLNQKNSLIQSLT
-
Nucleotide Sequence: 4104 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2615627-2611524 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGATAACCGTGCGGCCCGCGTGGGCGATGAGATCATTCATTCCAGCATTTTCGCTGATATCACCAGTA
TTGTCGCTGAGGGCGCAGCCTACGCGGTGATCGGTGCGGCGGTAGGTGCGGCGGCAACAGCAGCAGCACC
ATTGCTGGGGGCAGGAATGGCTGCGGCAGGCGTCGCAGCCATTGGTTCCAGCTGTCTGCTCAGCGGCATT
ATTGGCGGTGTATTAGCGAATGCTGCGGGCATTTCGGATGACATCACTAAAGCGGCCGATGGGCTGGGAG
ACATGATATTCCCGCCTTCTCCAGCCGGTGTGATCGCCAGCGGATCAGAGAATGTTCACGTTAATGGTCT
TTTAGCTGCACGCGCGGCCGGGATGCTTACGCCCGGAGATACGCCGCCACCGGAACCGCAATCGCCCAAG
AGTTTCGCAGACTATGGCGGCATGCTGCTCTCTGCGGTGGGTCAGTTTGGCAGTGCAATGTGGCAACCCA
CGGTAGCTTCCGCCGACGCTGGCGCCTCTCCGCTGGAGCAGGACAAAGTGGCCTGTGAAAAGCACAGCGC
ACCGCAATATCTGGCGCAGGGATCGAAAAGCGTCTTTATCAATGGCCAGCCTGCGGTGCGCGCAAAGGAT
AAAACCACCTGTGATGCCACCGTGAGTGACGATGTTTCCCCCAATGTCATCATTGGTGGTGAAACCGTCA
CAGTAAGAGAGATTAAAAGTGGCAAGGTGCCAGGTCTGGCCGTGATGATGATCGGCCTTTCCCTGATTCG
TGGTCGGCCCAGCCAGATTCTGAAAAACATGCCCTGCGCACTTGCTGGCGCGGTCGGTGGGATGATGGCG
GATATGGCGATCAACGCCGCCTTCTCATCGCTGTTTCCGGTTCATGCCTCCACGGGCGTCAAAGTGCTTA
ATGATGATGCCGAGCGCGATTTCTCCCTTCCTGGCCGCTTCCCGCTCAGTTTCCAGCGTAGCTATAACAG
CCTGACCCAGCGCAGCGGATTATTTGGTCTGGGCTGGGCGACGGTGTTTGACAGCTATATAACGCTGGAT
GGCAATCAGGCGACCTGGTTTGATGACAACGGGCGCGAGTTGAGCTTTGCGGTTCCCGGTGAAAAAGAGG
TGCTCTACAGCATCAGCGAAGGGCTGATGGTAAGGCGCAACGAACTGGGTGATATCGCCATTGCCGACGA
CGACGGTGCGGTATGGCGTCTGTACAGACGTACGGCCGCAGATCCGCAAGTGCTGCGGCTGGCTTCACTG
AGCGACGAATACGGCAATGCGCTGGAGATGGGCTGGGACGAACAGGCTCGCCTGGTGCGCATTCATGACG
CGCCGCTGGCCATTGACGTTACCCTGCATTACGACGACAAACAGCATGCACAGCGCCCGACCTCGGCCAG
TCACTTTGATGGTGAGCAGCACTGGCCATTAACGCTCTGGACTTACAATGAACAGGGCCAGCTTGCCAGC
GTCACCGATGCCGCAGGTGTTGTCTCGCGGCGCTTCCGTTACAACGATGACGGGTTAATGATCTGGCATC
AACTGCCGGGCGGGCTGGAAAGCGAATATCGCTGGCAGAAGCTGGATCACTGGCGCGTCGTTGAAAACCG
CACCAATACCGGTGACGGCTGCCATATGCATTATGATCTTGATGCTGGCATCACGCGCGTATCGACCTAT
GACGGTCAGCAGCGAGAACATCACTGGAATGCTGCAGGGCTCATCACCTGCTTTATTGATGAGCGGGGCG
AGACCTGGCGCTATGAGTGGGATGAAAACGAACTCCTGACGCGCCGTATCGATCCGCTGGGTAATGCGGT
GAGCTTCACCTATGACTATCTCGGCAACCGTGTAGAAGAGAAAGATGCGGACGGCGGTGTACAGGCGGTG
CAATGGCTGTCACACCGTTCTCTGCCCACGGTCGTTGCCGGGGCTGACGGTGCCACCACGAAATACTATT
ACGATCCCCATCATGGCCTTGAGCGCGTGGTTGATGCGCTCGGGCAGAGTACCTTCTATAAGCGGGATGA
GTTTGGGTTGGTTGTCGAAGAGATTGACGCGGCAGGCAACAGCTACCGTCGTGAATTCAATGATGCCGGC
CAGGTTATCCGCGAAACAGACTGTTCAGGGCTGACGACGCGCTACCGCTATCATCCCCTTGGCTGGCTCA
GCTGTGTGACTGCGCCGGATGGTGAAGAAACCCGGTATCACTATGATGCTGCGGGCCGTCCTGTTCTGCT
GGAGCGGGCAGAGGGCTGGGAAGAGCGATTGCGCTGGAGCGACAACGGCCTGCCACTGTCCCACGAGTCA
GCGGATGGTAAACGTAGTGACTTCCGCTACGACAACGTCGGGCGCTTAATCGCCAACCGTAATGCCCAGG
GCGAGACGGTTCAGCGCAGCTGGGACAGCCGTGGTCGGTTGACGGCGCTGCAAAACGAGAACGGCGAGCA
GTATCAGTTCGAGTGGGGGGCAGATTCCCTGTTGCTGGCCCAGGTTGGGCTGGATGGCGTTGCCACGCGA
TACGAGTATGACGCGGCAGGACGCACGTTATCTCGCACCTTTGCCGCCGGGCATCCTCAGGCGATTACCC
ATCGCTATCACTGGAGCCGGGCGGGGCAACTGCTGGCACGGACCACGCCGGAAGGCCAGACGCGCTATCA
CTACAGCGGTGGTGGGCAGTTAAGTAAAGTGTCGCAGCATCTGCCGCTGTCTGACACCGAGTGGAGCCAG
CAGGCCGAGCAGGAGATTGCGTTTACCTATGATGCGCTGGGCCGCATCGTAGGTGAGCAGGGTGAACAGG
GCGCGCTGGCCTGGGATTACGACGCGCTGGGTAACTGCACGGCCTTAACCCTGCCGGATGGTCGCAACCT
GAAGCAGCTTTACTACGGCAGCGGCCATTTACTGAGCATCGCGCTGGACAACCTGCCGGTCACCGAGTTT
ACCCGTGACACATTGCATCGGGAACTCAGCCGCACGCAGGGCGGCCTGACCACGCGCAGTGAGTATGATC
GGTTGGGCAGGCTGCGCCGCCGTGACGTTTTCAAAGGTGAAGCACAGCGTCCTGCGCCGCGCGTCTGGTC
CCGCCGGCGGGACTTCGATTACGGCAACAACCTGATCCGTGAAGAGCGCGACGATAACCCGTTCAGCCAG
ACATTATGGCACTACGATAACGCCGGTCGGCTGCTGTCTCAGGAAGGCGCGCAGCCGGGTAATGAGCAGT
GGCGCTGGGATGGCGCAGGCAACCCGCTGGATCGCCATGCCGCTTCCCACATCATGCATAACCGCGTCAC
TGAACTGAACGGTATCCGCTGGCAGTACGATATTCATGGCCGCACCACCGAAAAGGATGACGGCCAGACC
CGCTGGCGCTACCGTTACGATGGTGAGCACCGCCTGACGGATGTGATCAGCGAGCCACGTGACCGTAATA
GGCCGCGTACTAAGGTGAGTTTCCGCTACGATCCGCTGGGACGTCGCATCAGTAAAACCCGCCAGCAGCT
GTTACAGGGGAGACCATCTGGCAACGCCGTCACGACGCGCTTTGTGTGGGAAGGCTACCGCCTGCTGCAG
GAAATCCACGACGATATTCCACTTACTTACGTCTACAGCGACAGCCAGAGTTATGAACCTCTGGCCCGTA
TAGATGGCGTGGAAAGCCCGGAAATATTCTGGTTTCACTGCGCCGCGAATGGTACGCCAGAGCTGCTGAC
CGACGTTGAAGGCCAGAAGACCTGGGAAGGTGTGAACAGCCCATGGGGCAAACTGCTGCGCGAGTCTAAC
CAGCGAATTCCGGTGGTGGAGCAGAACCTGCGTATGCAGGGCCAGTACCTGGATCGTGAAACCGGGCTGC
ACTATAATTTGTTCCGTTATTATGATCCGGACAGCGGCCGGTTTACGCAGCATGACCCGATAGGGCTGGC
GGGCGGGATCAACCTTTACCAGTATGCGCCGAATGCGCTGGGCTGGGTGGATCCGTTGGGGTTAATGATT
TTCAACGGAAGACGAAAGGTGCATTCTCTACAAGGAAACAGGCTGGTCGAGCATACAATGCTACAAAAGG
GATTGTTAAACCAGAAAAATTCCCTGATCCAGTCACTTACTTAG
 Primer design