SecReT6
Effector Protein ID: 291617917
SecReT6 ID384
T6SS typeA3
Gene symbol-
Locus tagPANA_2364
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2634321..2634803 [-]
Producthypothetical Protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDD4GHL4
KEGG IDpam:PANA_2364
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|291617917|ref|YP_003520659.1| hypothetical Protein PANA_2364 [Pantoea ananatis LMG 20103]
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTLGVTYAFQAAKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2634803-2634321 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGCTATTGATATGTATTTGAAGGTAGACGGTATTACTGGTGAATCTAAAGATTCAAACCATACCGGCT
GGATTGATATTACCTCTTTCTCCTGGGGCGCTAATCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCTGGTAAAGTAAACTTCAACGACCTGCACATTAATGCCAAAATCGACAAGGCTGTCACTGCGCTGTTG
AAAAACTGTGCCAGTGGTAAGCACGTCACTAAGGTTGAAGTTTCAGTTTGCAAGGCTGGCGGTACGCAAA
TCGAGTACACCCGCATCACCCTGGAAGACGTGCTGGTCACCAACGTACAGTTCGTGGGCTCTGAGCACGA
TGATACGCTGGGCGTAACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGAGCTCT
TCTGGCGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATCAAAGAGAACAAAGAAGCATAA
 Primer design