SecReT6
Effector Protein ID: 291618000
SecReT6 ID384
T6SS typeA3
Gene symbol-
Locus tagPANA_2447
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2728452..2728934 [-]
Producthypothetical Protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDD4GHU7
KEGG IDpam:PANA_2447
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|291618000|ref|YP_003520742.1| hypothetical Protein PANA_2447 [Pantoea ananatis LMG 20103]
MAIDIYLKVEGTTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNFNDLRVKALIDKSTAAIL
KYCSSGKHVSKVELSVCKAGGNQIEYTKIVLEDVLVTATDFNGVGQGDTIVVDYAFQASKVSTSYWEQSA
SGTKGAESKAGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2728934-2728452 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGCGATTGATATTTATTTGAAAGTTGAAGGGACTACTGGAGAATCACAGGACAGCAATCATAAAGGAT
GGACCGACGTGCTCTCATTTAACTGGGGGGCTTCGCAACCCGGTAATATGGCGGTAGGTGGCGGTGGCGG
CTCAGGAAAAGTGAATTTCAACGATCTGCGTGTTAAAGCGTTAATCGACAAATCCACTGCTGCCATTCTT
AAATACTGCTCCAGCGGAAAGCATGTTTCAAAGGTAGAACTGTCGGTTTGCAAAGCCGGTGGCAACCAAA
TTGAGTACACGAAGATTGTGCTGGAAGATGTACTGGTTACGGCAACGGATTTTAACGGAGTAGGGCAAGG
TGACACCATTGTGGTGGACTACGCCTTTCAGGCATCCAAAGTGTCTACCAGCTACTGGGAACAAAGTGCC
AGCGGTACCAAAGGGGCGGAAAGCAAAGCCGGTTGGGATATTAAACAAAATAAAGAGAGCTGA
 Primer design