SecReT6
Effector Protein ID: 300715140
SecReT6 ID402
T6SS typeA3
Gene symbol-
Locus tagEbC_05520
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]650001..650492 [-]
ProductVirulence factor for secretion apparatus
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD8MMM6
KEGG IDebi:EbC_05520
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|300715140|ref|YP_003739943.1| unnamed protein product [Erwinia billingiae Eb661]
MAIPAYLWLKDDGGADIKGSVDVRYREGSIEINAFTHRVYTPTDNNTGKITGNRIHGAFILEKEFDSSST
YLYKAVASGQTLKSAELKWYKINDAGQEAEYFNMLLENVKVVSVSPIMHDCKDPAAQHQNHIENIELRYE
KITWKHCDGNLIFSDSWNERKTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|300714588|ref|NC_014306.1|:c650492-650001 Erwinia billingiae Eb661 chromosome, complete genome
ATGGCAATTCCAGCTTACTTATGGCTGAAAGACGATGGTGGCGCAGACATTAAAGGCTCTGTGGACGTAC
GTTACAGGGAAGGAAGTATTGAGATAAATGCTTTTACTCATCGTGTTTATACCCCTACGGATAATAACAC
AGGGAAAATCACTGGAAATCGCATACATGGCGCTTTTATCCTCGAAAAAGAATTTGATAGTTCATCTACC
TATCTGTACAAAGCGGTAGCTTCAGGCCAAACATTAAAATCTGCTGAATTGAAGTGGTACAAAATCAATG
ATGCTGGGCAAGAAGCAGAATACTTCAATATGCTACTTGAAAATGTGAAAGTAGTTTCAGTTTCCCCGAT
TATGCATGACTGTAAAGATCCGGCCGCACAACATCAAAACCATATTGAAAACATTGAATTAAGATACGAA
AAAATCACATGGAAACATTGTGATGGCAATTTGATTTTTTCCGATTCATGGAATGAACGTAAAACGGCTT
AG
 Primer design