SecReT6
Effector Protein ID: 317049953
SecReT6 ID502
T6SS typeA2
Gene symbol-
Locus tagPat9b_3755
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]4094887..4095369 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorSMA3455
DescriptionHcp protein
UniProt IDE6WH57
KEGG IDpao:Pat9b_3755
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-36, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|317049953|ref|YP_004117601.1| type VI secretion system effector [Pantoea sp. At-9b]
MAIDIYLKVDGTTGESQDSNHKGWTDVLSFTWGASQPGNMSVGGGGGAGKVAYRDLNIKALIDKSTPAIL
KFCSSGKHVDKVEVSICKAGGNQVEYSKITLEDVLVTQTDFNGVGQSDTIVVDYAFQASKVSMSYWEQGE
SGTKGAESKVSWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|317046238|ref|NC_014837.1|:4094887-4095369 Pantoea sp. At-9b chromosome, complete genome
ATGGCTATTGATATTTATTTGAAAGTTGATGGAACAACGGGTGAGTCCCAGGACAGCAATCACAAAGGAT
GGACCGATGTACTCTCCTTTACCTGGGGGGCTTCACAGCCAGGAAATATGTCAGTGGGCGGTGGTGGCGG
TGCCGGTAAAGTGGCTTACCGCGACCTCAATATTAAGGCGTTAATTGATAAATCCACCCCGGCGATTTTG
AAGTTTTGTTCCAGCGGTAAACATGTCGACAAAGTCGAAGTGTCAATTTGTAAAGCCGGTGGCAACCAGG
TGGAATATTCAAAGATCACTCTTGAAGATGTGCTGGTAACACAAACTGATTTTAACGGCGTAGGCCAGAG
CGACACCATCGTCGTGGATTACGCTTTCCAGGCATCCAAAGTCTCAATGAGTTACTGGGAACAGGGAGAA
AGTGGCACTAAAGGTGCCGAAAGCAAAGTGAGCTGGGACATTAAGCAGAATAAAGAAAGCTAA
 Primer design