SecReT6
Effector Protein ID: 317049954
SecReT6 ID502
T6SS typeA2
Gene symbol-
Locus tagPat9b_3756
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]4095415..4095897 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorSMA3456
DescriptionHcp protein
UniProt IDE6WH58
KEGG IDpao:Pat9b_3756
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|317049954|ref|YP_004117602.1| type VI secretion system effector [Pantoea sp. At-9b]
MAIDIFLKVDGINGESQNANHQNWIDVYSFSWGAKQPGNMAVGGGGGAGKVNYRDLTVQALVDKGTPALL
KYCSSGKHIAKVQLSICKAGGQEVEYTLITLEDVLVTQTDYIGVAHGSTLGMEYAFQASKVAMEYWEQTS
QGNKGASVQMGWDIKQNKEV
-
Nucleotide Sequence: 483 bp     [Download]
>gi|317046238|ref|NC_014837.1|:4095415-4095897 Pantoea sp. At-9b chromosome, complete genome
ATGGCGATAGATATTTTTTTAAAAGTCGATGGCATCAATGGTGAATCGCAAAATGCGAATCACCAAAACT
GGATCGATGTTTATTCATTTAGTTGGGGTGCAAAGCAGCCCGGTAATATGGCAGTCGGTGGCGGCGGCGG
TGCCGGTAAAGTGAATTACCGAGACCTGACGGTACAGGCGTTGGTTGATAAAGGCACCCCGGCATTATTG
AAATATTGCTCCAGCGGCAAACATATTGCCAAAGTTCAACTTTCAATCTGCAAAGCAGGTGGTCAGGAAG
TCGAATACACCCTTATTACGCTGGAAGATGTGTTGGTAACACAAACCGATTATATCGGCGTGGCGCATGG
CTCAACCCTGGGCATGGAGTACGCATTCCAGGCCAGTAAAGTGGCAATGGAGTATTGGGAACAAACCTCG
CAGGGGAATAAAGGTGCGTCAGTGCAGATGGGTTGGGATATCAAACAAAATAAAGAAGTCTAA
 Primer design