SecReT6
Effector Protein ID: 322835316
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4635
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]203988..204470 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE8Y149
KEGG IDrah:Rahaq_4635
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.80E-36, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|322835316|ref|YP_004215342.1| type VI secretion system effector, Hcp1 family [Rahnella sp. Y9602]
MAIPAYLWLKDDGGADIKGSVDVNGREGSIEVQGFGHGLFLPTDNNTGKITGTRVHSALTFEKEFDSSSP
YLYKAVAKGQTLKSAEIRWYRINDAGQEAEYFNMLMENVKVVSVCPLMHDCKNPATDKHNHLESISLRYE
RITWKHCDGNIIFSDAWNDR
-
Nucleotide Sequence: 483 bp     [Download]
>gi|322835126|ref|NC_015062.1|:203988-204470 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCAATACCCGCTTACCTATGGCTTAAAGATGACGGCGGCGCTGACATCAAAGGATCTGTCGATGTGA
ATGGGCGTGAGGGGAGTATCGAGGTTCAAGGATTTGGGCACGGCTTGTTTTTACCTACTGACAACAACAC
AGGCAAGATCACCGGTACTCGTGTACATTCCGCGCTGACTTTTGAAAAAGAATTCGATAGCTCATCGCCC
TACCTTTACAAGGCCGTCGCAAAAGGCCAAACCTTAAAATCTGCGGAGATAAGGTGGTACAGGATCAACG
ATGCTGGTCAGGAAGCTGAATATTTCAATATGCTGATGGAAAATGTAAAGGTCGTTTCTGTTTGCCCGCT
AATGCATGATTGCAAAAACCCTGCCACTGATAAACATAACCATCTTGAGTCAATTTCACTGCGTTACGAG
CGGATCACGTGGAAACATTGCGATGGGAATATCATTTTTTCAGATGCGTGGAATGACAGATGA
 Primer design