SecReT6
Effector Protein ID: 336125207
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_00299
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]2841667..2844927 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDF7YQM5
KEGG IDvan:VAA_00299
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1086 a.a.     [Download]
>gi|336125207|ref|YP_004567255.1| hypothetical protein VAA_00299 [Vibrio anguillarum 775]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDKQGQALHSLPEADRQWKGQFSTKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGSTLTKIEWSDDEASKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHLHAHFAQYLEDYVADIGTPAEQDIFKATCTPSL
PVEKSEEAAIDTEFKFVADKAVVSCSDYLQDLPEQNCGLFVALNDPLADVSDLFITFTTQVKKRTKAVGN
EEQQHAMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYWATAELAEMEFSQLASEGITPSK
ALSPMQQQADQQLAELKTLYRFEPTSAQMRKWRKKDNGFNDEVRWADLDNFLVEHYTQLKGLDEQIKQHY
AQFMSAFNQLGLDPILLGIDNQDEIQQAYLLALISQFLVAVTQVNHDEKALETLKKELSFDSPKNLMALA
STGFSLQANQAINSHIQDFSTSFLSTGNPSDMVAFSAAIANWDTFTGDGRIREKAWFKTWIEPVQSSFGA
LQKAVANQAKESWQVVMELLFPYQTQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAEIKQFETKL
NAILQEMNNALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAVMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMAVLENIRGKVAQYPSWDPSKNPALGEAIYATGYTIVAAGA
ISAGRAWKTIVKYELLDKSLKEALGEASSLKAKDALKTFSKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQALIFAIQLGVYGVSRFIGFGTIAAISAGWMAAGFAVIGIVYLIGVILTNVFK
RSELEIWLSKSMWGKESAHWSVGKELIELERLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLK
GQTIGLQITRLPAQPAYYQRQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLHWVK
EQSLKFCARGTRVGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3261 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c2844927-2841667 Vibrio anguillarum 775 chromosome I, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGGCAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATAAGCAAGGTCA
AGCATTACACTCTTTACCCGAAGCTGATCGACAGTGGAAAGGTCAATTCTCTACCAAGCAGCGTAGCTAC
ACCTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGTAGCACCTTGACCAAAATTGAGTGGTCTGACGATGAGGCAAGCAAACCCACTCACGAGCG
CGGCTCGAAAGGTGAAAGCAAAAGTTGTTTACTCTATCCCGCCCAGCACACTCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGTCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCTTCATGCGCATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCCGCTGAGCAGGATATTTTTAAAGCTACTTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGCGATAGATACCGAATTCAAGTTCGTGGCCGACAAAGCGGTGGTGA
GCTGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTATTACTTTTACTACCCAAGTGAAAAAGCGAACTAAAGCGGTTGGTAAT
GAAGAGCAACAGCATGCCATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCTATCCGTATTTTAGAGTTAGAAAGAGCCATTACTGAATA
TTGGGCTACGGCTGAATTAGCCGAAATGGAATTTAGCCAATTAGCCAGTGAAGGGATCACGCCATCAAAG
GCGCTTTCCCCCATGCAGCAGCAAGCGGATCAGCAATTGGCGGAATTGAAAACACTCTATCGTTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACGGTTTTAACGATGAAGTGCGCTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCCAACTCAAAGGATTGGATGAACAGATTAAACAGCACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTTGGCCTTGACCCGATTCTACTTGGTATAGATAACCAAGATG
AGATCCAGCAAGCGTATTTGTTAGCGTTAATTAGCCAATTTCTAGTGGCAGTTACGCAAGTCAATCATGA
TGAGAAAGCGCTTGAGACCCTCAAAAAAGAGCTCAGTTTTGATTCACCGAAAAACCTCATGGCGCTCGCG
TCAACAGGCTTTTCTCTGCAGGCGAATCAAGCCATTAACAGCCACATCCAAGATTTTAGCACCTCCTTTC
TCTCTACCGGTAATCCTAGTGATATGGTGGCGTTTTCGGCCGCGATCGCAAACTGGGATACTTTCACGGG
AGATGGCCGCATTCGGGAAAAAGCATGGTTTAAGACATGGATTGAACCCGTTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTAGCCAATCAAGCTAAAGAGAGTTGGCAAGTGGTGATGGAGTTGCTGTTTCCTTATC
AGACTCAGCCCAAAGGAGGAACGCCCAGTTTGCTGGCTAACCTTCGCTTATTATTAGTGGAAAGCCTAGT
ACGAGAAGAGGCGGTGTTGCAACATAACCCCAAGTATGCGGCTGAGATTAAGCAATTTGAGACTAAGTTG
AATGCCATCTTGCAAGAGATGAATAATGCTCTGGAACTCAAGCCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAACTGCCGATGATGCT
GACGCTCAAAAACCAAGCGGTGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGTTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAAAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCAC
TGAACCTATGGAATACCATGGCGGTTTTGGAGAATATCCGCGGTAAGGTCGCACAATACCCCAGTTGGGA
TCCTTCGAAGAATCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCTATACCATTGTGGCCGCCGGTGCC
ATCAGTGCTGGGCGCGCTTGGAAGACGATTGTTAAATATGAGCTTTTGGATAAATCACTAAAAGAAGCAT
TAGGTGAGGCATCCAGCCTTAAAGCCAAAGATGCCCTAAAAACTTTTTCTAAATCCATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTATTAAAAGCAGGGGCAACGGGAGCACAGGCTCTGATTTTTGCTA
TTCAGTTAGGTGTATACGGAGTAAGTCGATTCATAGGTTTTGGAACAATCGCAGCCATCAGTGCTGGTTG
GATGGCCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAA
CGCTCAGAGTTAGAAATCTGGTTATCAAAATCGATGTGGGGGAAAGAGAGTGCTCATTGGTCGGTGGGCA
AAGAATTGATCGAGTTAGAGCGCCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAA
AGCAGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTAGAACTCACGTTACCCGATTATCTTAAA
GGGCAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACGGCAAAGGGAGG
CGGTAACACCAATACTCATCAATGAACAACAGGGAAAATGGAGTATTGAAGATAATCAGCCTGTGTATCG
CATTACACTGGGTGGCAGTGAGAAGGATACCGTTGGAGTTTGCGTTGCACTGCCCCTGCACTGGGTCAAG
GAACAGAGTCTCAAATTTTGCGCCCGCGGAACTCGCGTGGGGGAATTAGATTTACAATCTGCAGAGGCGA
ATGATATTGCCACAAGAAATCTCGTTGTAGGAAAGGGTTAA
 Primer design