SecReT6
Effector Protein ID: 336125209
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_00297
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]2845811..2847907 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDF7YQM6
KEGG IDvan:VAA_00297
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-62, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 5.10E-23, Aligned region: 375..468
DUF2345 [PF10106], Evalue: 0.00098, Aligned region: 575..619
Phage_Mu_Gp45 [PF06890], Evalue: 0.0028, Aligned region: 427..454
Phage_Mu_Gp45 [PF06890], Evalue: 0.0028, Aligned region: 571..606
Protein Sequence: 698 a.a.     [Download]
>gi|336125209|ref|YP_004567257.1| VgrG protein [Vibrio anguillarum 775]
MATLNFTLKVDGLADDAFVVREYQGQESLSESVLANGEPCYGFRYHIELASRQSTLSAIDVVDKTAQLTV
FRNGGVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALERLSLRQNSRIFQLKTVPEILSIVLQEMGIDDY
AFALKRECLQREFCVQYRETDIHFLHRLAAEEGLVYHLLHEEGKHTLIFSDDSQSLTKLDTPIPYNVLSG
GIVDTPYISNLISHTQSQVAESQLADYSFKKPIYGFKQSALGTAMDYQQTHYEHFDFPGRFKDDESGKAF
NQIRLEYLRRQARTAQGQSNEARLQAGTLFDLAEHLDDSVNRDWVVVQVNHQGRQPQALEESGGSGATTY
SNQFTLIPADVTWRATPHTKPQVDGPCIAHVVGPDGEEIFCDEYGRVKLHFPWDRYSNGDEHSSCWVRVS
QGWAGSQYGMMAIPRIGHEVIVDFLNGDPDQPIVTGRAYHATNKAPYTLPDNKTKTVLRSETHQGEGFNE
LSFEDQAGQEKIYLHAQKDYEALVLNDSTTHIKHDKHLTVDNDQFSHIKNNQHLTVEGESRQKIALDRSL
DVGGSLHQKIGEKTVFDSGNEVHLKAGNKLVLDAGNEITIKAAGSFIKVDGGGVYLVGPAINLNSGGSAG
SGSGYGGVVAALPQGVDEAKTPQDIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEVCEEAKGN
-
Nucleotide Sequence: 2097 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c2847907-2845811 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGCCACGCTGAATTTTACGTTAAAGGTTGACGGGCTCGCCGACGATGCATTTGTGGTGCGAGAATACC
AAGGACAAGAATCCTTATCGGAGAGTGTGCTGGCCAATGGCGAGCCTTGTTATGGGTTTCGTTACCACAT
TGAGCTAGCAAGCCGTCAATCAACTTTGAGTGCAATCGATGTCGTCGACAAAACGGCTCAGCTAACGGTT
TTTCGTAATGGCGGGGTGGTGCAGCGCGTGCATGGCATCGTGCGCCAGTTTAGTAAAGGCGATATTGGTC
ATCATCACACCTTTTACTCACTCACTTTAGTGCCTGCATTAGAGCGCTTGTCGCTGCGCCAAAATAGCCG
CATCTTCCAGCTTAAAACTGTACCTGAAATTCTTTCCATTGTGCTGCAAGAAATGGGCATTGACGACTAC
GCCTTCGCACTTAAACGAGAATGTCTTCAGCGCGAATTCTGCGTACAGTACCGTGAAACCGATATCCACT
TTTTACACCGCTTAGCCGCTGAAGAGGGCTTGGTCTACCACCTCCTGCATGAAGAAGGTAAACATACCCT
CATTTTCAGTGACGACAGTCAAAGCTTAACGAAGCTCGATACACCGATCCCTTACAATGTGCTGTCCGGT
GGTATCGTTGATACGCCTTACATTTCCAACTTAATCAGCCATACGCAATCGCAAGTGGCGGAAAGCCAAT
TGGCGGATTACAGCTTTAAAAAACCGATTTACGGTTTTAAGCAAAGTGCACTCGGCACCGCGATGGATTA
CCAGCAGACCCACTATGAACATTTTGATTTCCCGGGTCGATTTAAAGACGATGAGAGCGGTAAAGCGTTT
AATCAAATTCGTTTAGAGTACCTAAGAAGGCAGGCGCGTACCGCACAAGGCCAAAGCAATGAAGCGCGTT
TGCAAGCCGGAACCCTGTTTGATTTGGCCGAACATTTAGACGACAGCGTGAACCGAGATTGGGTTGTGGT
GCAAGTAAACCATCAAGGCCGGCAGCCGCAAGCATTAGAAGAGTCTGGCGGTAGTGGTGCAACGACCTAC
AGTAACCAATTTACCTTGATCCCGGCCGATGTAACGTGGCGCGCAACACCACACACCAAGCCGCAAGTGG
ATGGCCCATGCATCGCCCACGTGGTTGGCCCCGATGGCGAAGAGATCTTCTGCGATGAGTATGGCCGCGT
TAAACTGCATTTCCCATGGGACAGATATTCTAACGGCGATGAGCACAGTTCATGTTGGGTGAGGGTGTCG
CAAGGTTGGGCTGGCAGCCAATATGGCATGATGGCTATCCCAAGAATTGGCCATGAAGTGATTGTCGATT
TTTTAAACGGTGATCCGGATCAACCCATAGTCACGGGCCGCGCTTATCACGCCACCAATAAAGCGCCCTA
CACACTGCCAGATAACAAAACCAAAACCGTACTGCGCAGTGAAACCCACCAAGGTGAAGGCTTTAATGAG
CTGAGTTTTGAAGATCAAGCAGGGCAAGAGAAAATCTACCTGCACGCGCAAAAAGACTATGAAGCGCTAG
TGCTTAATGATTCCACCACACACATCAAACACGATAAACACCTGACAGTGGATAACGACCAGTTCAGCCA
CATTAAAAATAACCAACACCTAACGGTTGAGGGCGAAAGCCGTCAGAAAATAGCGTTAGATCGTAGCCTT
GATGTGGGTGGTTCACTGCACCAAAAAATCGGTGAAAAAACGGTTTTTGACTCAGGTAATGAAGTGCACC
TTAAAGCAGGCAATAAGTTGGTGTTAGATGCGGGTAATGAGATCACCATTAAAGCTGCGGGCAGTTTTAT
CAAAGTGGATGGCGGCGGCGTGTACCTAGTCGGGCCTGCGATCAACCTTAACTCCGGTGGCAGCGCAGGC
AGCGGCTCGGGTTATGGCGGTGTTGTAGCGGCGTTGCCACAAGGGGTTGATGAAGCCAAAACGCCGCAAG
ATATTGAGCTAGCAGCGGTAACTCCCACTCAGCAATCCATGTCACCTTTACTTAAGGCGCGACAAATTGA
AGCACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA
 Primer design