SecReT6
Effector Protein ID: 336125210
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_00296
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]2848047..2848565 [-]
ProductHemolysin co-regulated protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDF7YM31
KEGG IDvan:VAA_00296
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-35, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|336125210|ref|YP_004567258.1| Hemolysin co-regulated protein [Vibrio anguillarum 775]
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQMFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTKLESASIVDIHCEMPHCQDPANGDFTQ
NVTVSMSYRKILWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c2848565-2848047 Vibrio anguillarum 775 chromosome I, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCGAAACTCAGGGTCTCATCACTGCTGGCGCTCTTTCTA
CTGACTCTATCGGCGATGCTTTCGTTGAAGGTCATGAAGATCAAATGTTGGTTCAAATGTTTGACCACGT
TGTGACAGTACCGACTGACCCACAATCAGGTCAGCCTTCTGGTCAACGTGTTCACAAACCATTCAAATTC
ACCGTTGCGCTAAATAAAGCGGTTCCTCTTCTTTATAACGCGTTGGCGTCTGGCGAGAAGATGAAATCGG
TTGAGCTAAAGTGGTACCGCACGTCTATCGAAGGCAAACAAGAGAACTTCTTCACCACTAAACTTGAAAG
CGCGTCTATCGTGGACATTCATTGCGAAATGCCACACTGCCAAGATCCTGCGAACGGCGACTTCACGCAA
AACGTTACGGTTTCTATGTCTTACCGTAAAATCCTGTGGGATCACGTGAACGCGGGTACTTCAGGTTCAG
ATGACTGGCGCAAACCAGTAGAAGCGTAA
 Primer design