SecReT6
Effector Protein ID: 336125843
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_01943
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]471428..471946 [-]
Producthemolysin co-regulated protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDF7YSV8
KEGG IDvan:VAA_01943
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-35, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|336125843|ref|YP_004577799.1| hemolysin co-regulated protein [Vibrio anguillarum 775]
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTTLESASIVDIHCEMPHCQDPANGDFTQ
NVTVSMSYRKILWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|336125405|ref|NC_015637.1|:c471946-471428 Vibrio anguillarum 775 chromosome II, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCGAAACTCAGGGCCTGATCACTGCTGGTGCTCTGTCTA
CTGATTCAATCGGTGATGCGTTCGTTGAAGGTCATGAAGACCAAATGTTGGTTCAACAATTTGACCACGT
TGTAACTGTACCGACTGATCCACAATCAGGTCAGCCTTCTGGTCAACGTGTTCACAAACCATTTAAATTC
ACCGTAGCGCTAAACAAAGCGGTTCCTCTTCTTTATAACGCACTGGCGTCTGGCGAGAAGATGAAATCGG
TTGAGCTAAAATGGTACCGCACTTCTATCGAAGGTAAGCAAGAGAACTTCTTCACTACTACACTCGAAAG
CGCGTCTATCGTGGACATTCACTGTGAAATGCCACACTGCCAAGATCCAGCGAACGGCGACTTCACACAA
AACGTTACGGTTTCTATGTCTTACCGTAAAATCCTGTGGGATCACGTGAATGCGGGTACTTCAGGCTCTG
ACGACTGGCGCAAGCCTGTTGAAGCGTAA
 Primer design