SecReT6
Effector Protein ID: 336125979
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_02849
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]631582..633666 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein
UniProt IDF7YT84
KEGG IDvan:VAA_02849
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-68, Aligned region: 53..347
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 386..479
DUF2345 [PF10106], Evalue: 0.00045, Aligned region: 508..632
Protein Sequence: 694 a.a.     [Download]
>gi|336125979|ref|YP_004577935.1| VgrG protein [Vibrio anguillarum 775]
MLFCDKRVEGKKMARLSFRLTVEGLADDTLVVHEYQGVESLSDSTQAGLRCYGFRYEIKLASRQSGLTAL
ELVDKTAQLEILRDDLVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALERLSLRQNSRIFQLKTVPEILS
IVLQEMGINDYAFSLKRECAQREFCVQYRETDIDFLHRLAAEEGLVYHFIHEEGKHTLFFSDDSQSLTKR
ETPIPYNVLAGGVMESPYVSQLTQHSQTEVSHSALQDYSFKKPSYSFAQQAQGREMDYQQATYEHFDAPG
RFKDDISGKAFNQIRLEYLRREARTATGKSNHPGLQAGTKFDLQEHLDDSANRDWVVVQVHHQGQQPQAL
EEEGGSGATTYSNQFTLIPADVTWRATPQAKPQVDGPCMALVVGPDGEEIFCDEHGRVKLHFPWDRYSNG
DEHSSCWVRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNKAPYALPDNKTKTVLR
SETHQGEGFNELSFEDQAAQEKIYLHAQKDLDALVLNDATAHIKHDQHLTVDNDQFTHVKHNQHLTVEGE
SRESVKGSCILMVDGSLHVKSGQVWTNESGDEIHIKAGQKVVIEAGSEITVTAGGSFVKVDPAGVHLSGA
GVNLNSGGSAGSGSGFSGDLPLLPGELELQKSPAPPQTILYQALLQAEEARVPAVKVCPLAGDA
-
Nucleotide Sequence: 2085 bp     [Download]
>gi|336125405|ref|NC_015637.1|:631582-633666 Vibrio anguillarum 775 chromosome II, complete sequence
GTGTTATTTTGCGATAAAAGAGTGGAAGGGAAAAAGATGGCAAGGTTAAGTTTTAGGCTCACCGTGGAGG
GTTTGGCAGACGACACGTTAGTGGTGCATGAATACCAAGGTGTGGAATCGCTGTCTGATAGCACGCAAGC
GGGCCTGCGCTGCTACGGTTTTCGCTATGAGATAAAACTGGCCAGTCGTCAATCTGGCTTAACGGCACTG
GAGCTGGTGGACAAAACCGCTCAGCTTGAGATACTGCGTGATGACCTTGTCGTGCAGCGCGTGCACGGCA
TTGTGCGCCAGTTCAGTAAAGGCGATATTGGCCATCATCACACCTTTTACTCACTGACCTTAGTCCCGGC
ATTAGAGCGGTTATCACTGCGCCAAAACAGCCGCATCTTCCAGCTCAAAACCGTTCCCGAAATCCTCTCC
ATCGTACTGCAAGAAATGGGCATTAACGACTACGCCTTCTCGCTGAAGCGCGAGTGTGCACAGCGTGAAT
TCTGCGTGCAGTACCGTGAGACGGATATCGACTTCTTGCACCGCTTAGCCGCCGAAGAAGGCTTGGTGTA
TCACTTCATTCATGAAGAGGGGAAACACACCCTCTTTTTCAGTGACGACAGCCAAAGCCTGACGAAGCGA
GAAACGCCTATCCCTTACAACGTCCTTGCGGGTGGCGTGATGGAGAGCCCTTATGTGTCGCAATTAACGC
AACACAGCCAAACCGAAGTGAGCCACAGCGCGCTGCAAGATTACAGCTTTAAAAAGCCGAGCTACTCGTT
TGCCCAGCAAGCGCAAGGGCGCGAAATGGATTACCAGCAAGCGACCTACGAGCACTTTGATGCACCGGGT
CGCTTTAAAGACGACATCAGCGGCAAAGCCTTTAATCAAATTCGCTTAGAGTACTTACGACGAGAAGCGC
GTACCGCGACCGGAAAAAGTAACCATCCGGGCCTGCAAGCGGGCACAAAGTTCGACTTACAAGAGCATCT
TGACGACAGCGCGAACCGCGATTGGGTTGTCGTGCAAGTGCATCATCAGGGGCAGCAGCCACAAGCATTG
GAAGAAGAGGGCGGCAGTGGCGCGACCACGTACAGCAACCAATTCACGCTCATTCCTGCTGATGTCACGT
GGCGTGCGACACCGCAAGCCAAACCTCAAGTGGATGGCCCTTGCATGGCATTGGTGGTGGGGCCTGATGG
CGAAGAAATCTTCTGTGACGAACATGGCCGCGTCAAACTGCATTTCCCGTGGGACAGATATTCCAACGGC
GATGAACACAGCTCATGCTGGGTGCGCGTCTCACAAGGTTGGGCTGGCAGCCAATATGGCATGATAGCCA
TTCCGCGCATTGGTCATGAAGTCATCGTCTCGTTTCTTAACGGCGACCCAGACCAACCGATAGTGACAGG
CCGTACCTACCATGCGACCAATAAAGCGCCGTACGCACTGCCGGATAACAAAACCAAAACCGTGCTGCGC
AGTGAAACGCACCAAGGAGAAGGGTTTAACGAGCTGAGTTTTGAAGACCAAGCAGCGCAAGAGAAAATCT
ACCTACACGCGCAAAAAGACTTAGACGCCTTGGTGCTCAATGACGCCACGGCGCACATCAAGCACGACCA
GCACCTCACGGTGGATAACGACCAATTCACGCACGTTAAACATAACCAGCACCTCACGGTGGAGGGCGAA
AGCCGCGAATCGGTTAAGGGTAGCTGTATATTAATGGTCGATGGTTCCTTGCACGTAAAATCAGGGCAAG
TTTGGACTAATGAAAGTGGAGATGAAATCCACATCAAAGCTGGACAAAAAGTGGTGATTGAAGCAGGGTC
AGAAATTACCGTGACAGCCGGTGGCAGTTTTGTCAAAGTCGATCCTGCTGGTGTCCATCTTTCTGGGGCG
GGCGTTAATTTAAACTCAGGCGGAAGTGCGGGCAGTGGCAGTGGTTTTAGTGGCGATTTACCGTTATTAC
CTGGTGAGCTTGAACTGCAAAAATCCCCCGCGCCACCTCAAACCATTCTTTACCAAGCGCTATTGCAAGC
TGAAGAAGCACGAGTGCCAGCCGTAAAAGTATGCCCATTAGCCGGGGATGCCTAA
 Primer design